KEGG   Pandoraea apista: SG18_06230Help
Entry
SG18_06230        CDS       T03588                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
papi  Pandoraea apista
Brite
KEGG Orthology (KO) [BR:papi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    SG18_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJE97877
UniProt: A0A0B5FCT5
Position
complement(3335037..3335411)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFTVTVRPQYLPEQSEPDRRQFAFAYTITIRNSGEVPAQLISRHWVITDGDNHVQE
VNGLGVVGHQPFLQPGEQFEYTSWAMVATPVGTMRGEYFCVAEDGTRFEAPIAEFALTMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaatttaccgtcacggtgcgcccgcaatatctcccggagcaatcggaa
ccggaccgtcggcaattcgccttcgcctacacgattacgattcgcaacagcggggaagtg
ccggcccaactgatttcgcgtcattgggtaatcacggacggcgacaaccatgtgcaggaa
gtgaacggtctgggcgtggtcggccatcaaccgtttctgcaacccggtgagcaattcgag
tacacgagctgggccatggtcgccacgcccgtgggcacgatgcgtggcgagtacttctgc
gtggcagaggatggcacgcggttcgaagcgcccatcgccgagttcgcgctgaccatgccg
cgcaccttgcactga

DBGET integrated database retrieval system