KEGG   Pandoraea apista: SG18_10930Help
Entry
SG18_10930        CDS       T03588                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
papi  Pandoraea apista
Pathway
papi00071  Fatty acid degradation
papi00072  Synthesis and degradation of ketone bodies
papi00280  Valine, leucine and isoleucine degradation
papi00310  Lysine degradation
papi00362  Benzoate degradation
papi00380  Tryptophan metabolism
papi00620  Pyruvate metabolism
papi00630  Glyoxylate and dicarboxylate metabolism
papi00640  Propanoate metabolism
papi00650  Butanoate metabolism
papi00900  Terpenoid backbone biosynthesis
papi01100  Metabolic pathways
papi01110  Biosynthesis of secondary metabolites
papi01120  Microbial metabolism in diverse environments
papi01130  Biosynthesis of antibiotics
papi01200  Carbon metabolism
papi01212  Fatty acid metabolism
papi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:papi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SG18_10930
   00630 Glyoxylate and dicarboxylate metabolism
    SG18_10930
   00640 Propanoate metabolism
    SG18_10930
   00650 Butanoate metabolism
    SG18_10930
  Lipid metabolism
   00071 Fatty acid degradation
    SG18_10930
   00072 Synthesis and degradation of ketone bodies
    SG18_10930
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SG18_10930
   00310 Lysine degradation
    SG18_10930
   00380 Tryptophan metabolism
    SG18_10930
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SG18_10930
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SG18_10930
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SG18_10930
Enzymes [BR:papi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SG18_10930
Exosome [BR:papi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SG18_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJE98568
UniProt: A0A0B5FFN3
Position
complement(4426866..4428050)
Genome map
AA seq 394 aa AA seqDB search
MQQDPIVIVSAARTPMGGLQGVFGEVAAPQLGAAAIRAAVERAGLKPEQVDEVVMGCVLP
AGQGQAPARQATLGAGLPLAAGATTVNKMCGSGMRAAMFAHDMLVAGSADVIVAGGMESM
SNAPYLLPKARAGMRMGHGQVIDHMFFDGLEDAYDKGRLMGTFAEECADRYAFTREAQDN
FAIASLERAQNATKDGSFAWEITPVTVPGRKGDTVVDQDEQPFKANPEKIPTLKAAFRKD
GTVTAANSSSISDGAAALVLMRESTAKRLGLAPLARIAGHSTFAQQPGLFTTAPVGAMRK
LFEKTGWSTKDVDLYEINEAFAVVTMAAMHEFGLPHDKVNIHGGACALGHPIGASGARIL
VTLIGALRKTGGKRGVASLCIGGGEATAMAIELV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaagacccgatcgttatcgtttccgccgcccgcacgcccatgggcggcctgcaa
ggggtgttcggcgaagtcgccgcaccgcaactgggcgcggccgccattcgcgccgccgtc
gaacgcgccggcctcaagccggaacaggtcgacgaagtggtgatgggctgtgtgctgcct
gccgggcagggtcaggcccctgcgcgtcaggccacgctcggcgccgggctgccgctcgcc
gccggcgccaccaccgtcaacaagatgtgcggctccggcatgcgcgccgcgatgttcgcg
cacgacatgctcgttgccggcagtgccgatgtgatcgtcgccggtggcatggaaagcatg
agcaacgccccctatctgctgcccaaggcgcgcgccggcatgcgcatggggcacggtcag
gtcatcgaccatatgttcttcgatggcctggaagacgcctacgacaagggccgcctgatg
ggcaccttcgccgaggaatgcgccgaccgttacgccttcacccgcgaagcacaggacaac
ttcgccatcgcctcgctcgaacgcgctcagaacgccacgaaagacggctcgtttgcgtgg
gaaatcacaccggtgacggtgccgggccgcaagggcgacaccgttgtcgatcaggatgaa
cagccgttcaaagccaatcccgagaaaatcccgacgctcaaggcggccttccgcaaggac
ggcacggtgactgccgccaactcgtcgtcgatttcggacggtgccgccgcgcttgtgctc
atgcgcgaatccacggccaaacgcctcggcctcgcgccactcgcacgcattgccggccac
agcaccttcgcccagcaaccgggtctgttcacgactgccccggtcggcgccatgcgcaag
cttttcgagaagaccggctggtcgacgaaggacgtcgatctctacgaaatcaacgaagcc
ttcgcggtcgtcacgatggccgcaatgcatgagttcggtctgccgcacgacaaggtcaat
attcacggcggcgcctgcgcgctcggtcacccgatcggcgcatccggcgcgcgaattctg
gtcacgctgatcggcgcactgcgcaagaccggcggcaaacgtggcgtggccagtctgtgt
atcggcggtggcgaagccacggccatggccatcgaactcgtctga

DBGET integrated database retrieval system