KEGG   Pandoraea apista: SG18_18610Help
Entry
SG18_18610        CDS       T03588                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
papi  Pandoraea apista
Brite
KEGG Orthology (KO) [BR:papi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SG18_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJE99712
UniProt: A0A0B5FI63
Position
726585..727595
Genome map
AA seq 336 aa AA seqDB search
MATLHISLWLIGLLIALALLFDFMNGFHDAANSIATVVSTGVLKPHQAVAFAAMFNVIAL
FVFHLKVAATVGKGTVHPEIVDHYVIFGALVGAIAWNIITWYYGIPSSSSHALIGGLVGA
AVAKAGTGSLVASGLLQTVAFIFISPLLGFVLGSFFMLLVSWLFFRTPPARVDRWFRRLQ
LVSAGMYSLGHGGNDAQKTIGIIWMLLIAAGMWPQEAAEPPLWVIVGCYLAIGLGTMFGG
WRIVRTMGQKITKLKPVGGFCAETGGAFTLFFASWLGVPVSTTHTITGAIVGVGATRKLS
AVRWGVAGNIVWAWVLTIPASAFIAAIAWWVGKQIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgctgcacatcagcctctggctgatcggactattgatcgctctggcgctcttg
ttcgacttcatgaacggctttcacgacgccgccaactccatcgctacggtggtttcgacg
ggcgtgctcaagccgcatcaggcggtggcattcgccgccatgttcaacgtcatcgcattg
ttcgtctttcacctgaaagtcgcggcgacggtgggcaaggggacggttcaccccgagatc
gtcgatcactacgtgatttttggcgccctcgtgggcgctatcgcgtggaacatcatcacc
tggtactacggcattccgtcgagttcgtcgcatgccctgatcggtggtctggtcggcgct
gcggtggccaaggcgggcacggggtcgctcgtcgcgagcggtctgctgcaaaccgtggcg
ttcattttcatctcgccgctgctgggcttcgtgctgggctcgttcttcatgctgctggtg
tcgtggctgttctttcgcacgccacccgctcgcgtggatcgctggttccgtcgcctgcaa
ctggtctcggccggtatgtacagcctggggcacggcggtaacgacgcacagaagaccatc
ggtattatctggatgctgctgattgccgccggcatgtggccgcaggaagcggctgagccg
ccgctgtgggtgatcgtgggctgctatctggcgatcggtctgggcaccatgttcggtggc
tggcgtatcgtgcgcacgatggggcaaaagatcaccaagctcaagccggtgggtggcttt
tgcgccgaaacgggtggggcgttcaccctgttcttcgcctcatggctcggcgtgccggtc
tcgaccacgcatacgattaccggggccattgtgggggtcggcgccacgcgtaagctctcg
gcagtacgctggggggtggccggcaatatcgtctgggcatgggtgctgacgatcccggcc
tcggcgttcatcgcggcgattgcctggtgggtcggcaagcagatcctgtga

DBGET integrated database retrieval system