KEGG   Pandoraea apista: SG18_22270Help
Entry
SG18_22270        CDS       T03588                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
papi  Pandoraea apista
Pathway
papi00071  Fatty acid degradation
papi00072  Synthesis and degradation of ketone bodies
papi00280  Valine, leucine and isoleucine degradation
papi00310  Lysine degradation
papi00362  Benzoate degradation
papi00380  Tryptophan metabolism
papi00620  Pyruvate metabolism
papi00630  Glyoxylate and dicarboxylate metabolism
papi00640  Propanoate metabolism
papi00650  Butanoate metabolism
papi00900  Terpenoid backbone biosynthesis
papi01100  Metabolic pathways
papi01110  Biosynthesis of secondary metabolites
papi01120  Microbial metabolism in diverse environments
papi01130  Biosynthesis of antibiotics
papi01200  Carbon metabolism
papi01212  Fatty acid metabolism
papi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:papi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SG18_22270
   00630 Glyoxylate and dicarboxylate metabolism
    SG18_22270
   00640 Propanoate metabolism
    SG18_22270
   00650 Butanoate metabolism
    SG18_22270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SG18_22270
   00072 Synthesis and degradation of ketone bodies
    SG18_22270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SG18_22270
   00310 Lysine degradation
    SG18_22270
   00380 Tryptophan metabolism
    SG18_22270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SG18_22270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SG18_22270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SG18_22270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:papi04147]
    SG18_22270
Enzymes [BR:papi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SG18_22270
Exosome [BR:papi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SG18_22270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJF00219
UniProt: A0A0B5FKG7
Position
complement(1591015..1592196)
Genome map
AA seq 393 aa AA seqDB search
MQREVVIVSGVRTAIGDFGGSLKDFAPTQLGAIVAREAMTRANVGGEDIGHVVFGNVIHT
EPKDMYLARVASIEAGVSQHAPAMTVNRLCGSGLQAVVSAAQSILLGDTDVAMAGGAESM
SRAPYVMPGARWGTRMGESRLVDMMLGALHDPFANIHMGVTAENIAKKWGITREDQDLLA
VESHRRAAHAMASGYFTDQIVPVTIKSKKGDISFVTDEHVRAGLSMEDMAKLRPVFEKDG
TVTAGNASGLNDAAAALILMERAEAERRGAKPLARLVSYAHAGVDPNYMGIGPVPASRKA
LERAGLKVGDIDVVEANEAFAAQACAVTRDLGFDPAKVNPNGSGISLGHPIGATGALITV
KALHELQRIGGRYALVTMCIGGGQGIAAVFERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgagaggtcgtgatcgttagcggtgtgcgcaccgccattggcgattttgggggc
agcctgaaggatttcgcgccaacgcagcttggcgccatcgtcgcccgcgaggccatgacc
cgcgcgaatgtcggcggcgaagacatcggacacgtcgtattcggcaacgtcattcacacc
gaaccgaaggacatgtatctggcacgcgtggcgtccattgaggctggcgtgagccagcac
gcgcccgcgatgaccgtgaaccgcctgtgtggctcggggttgcaggcggttgtgtccgcc
gcgcagtcgatcctgctgggtgacacggatgtcgcaatggcgggcggcgccgagagcatg
agccgcgcaccgtatgtcatgcccggcgcccgttgggggacacgcatgggtgagtcgcgt
cttgtcgacatgatgctcggcgcactgcatgacccgtttgccaacatccacatgggcgtg
acggcggagaacatcgcgaagaagtggggcatcacgcgcgaagatcaggaccttctggcg
gtcgagtcgcatcgacgcgccgcacacgccatggcgtcgggctatttcaccgaccagatt
gtgcccgtcacgatcaagtcgaagaagggcgacatttcgttcgtcaccgacgagcacgtg
cgcgctggcctgagcatggaagatatggcgaagctgcgcccggtgttcgagaaagacggt
acggtgaccgccggtaacgcctccggtctgaacgacgccgcggcggcgctcattctgatg
gagcgcgcagaggccgagcgacgcggcgcgaagccgctggcgcgactggtgagctatgcc
catgccggcgtcgatccgaattacatggggattggtcccgtgccggcgtcgcgcaaggcg
ctcgagcgtgctggcctcaaggtcggggacattgatgtggtcgaagccaacgaggctttt
gcggctcaggcatgtgccgtcacgcgtgatctcggttttgatccggccaaggtcaatccg
aacggttcgggcatttcgctggggcatccgattggcgcaaccggtgcgctgattacggtc
aaggcgctgcatgagttgcagcgcattggcggccgctatgcgctcgtcaccatgtgtatc
ggcggcgggcagggcattgcagccgtgttcgagcgcgtgtaa

DBGET integrated database retrieval system