KEGG   Pantoea ananatis PA13: PAGR_g0102Help
Entry
PAGR_g0102        CDS       T01970                                 

Definition
(GenBank) phosphatase YihX
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00010  Glycolysis / Gluconeogenesis
paq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g0102
Enzymes [BR:paq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     PAGR_g0102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PerC CysA_C_terminal SHOCT
Motif
Other DBs
NCBI-ProteinID: AER30643
Position
119275..119898
Genome map
AA seq 207 aa AA seqDB search
MIQGTRGGTMLYIFDLGNVIIDIDFNRVLGVWSDLSRVPLASLQSHFHMDDAFEQHERGE
ISDEAFAEALCEKLDIALSYEQFAAGWQAVFVGVRPETLAVMHQLRQAGHRVVILSNTNA
LHCTFWPTQYPDVQQAADKIYLSQELGMRKPEARIYQHVLDAEGVSADQAVFFDDNAANI
EGARALGINSVLVTDSTTVPDWFAGQH
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatccagggaacccgaggaggcaccatgctgtatatctttgatttgggcaatgtgatt
atcgatatcgactttaaccgcgtactgggcgtctggagtgacctcagccgcgtgccgctg
gcctcgcttcaaagccacttccatatggatgacgcatttgaacagcatgagcgtggcgaa
atcagtgatgaggcctttgcagaagccctgtgtgagaagctggatatcgcgctgagctat
gaacagttcgcggcaggctggcaggcggtttttgtgggtgtccggccggagacgctggcc
gtaatgcaccagctaagacaggcgggacatcgggtggtgattctctccaacaccaacgcc
ctgcactgtaccttctggccaacgcaatatcctgacgtacagcaggcggctgacaagatc
tacctgtcacaggagctgggcatgcgtaaacctgaagcgagaatctatcagcatgtgtta
gatgctgaaggggtgagcgccgatcaggccgtgttcttcgatgacaatgccgcgaatatt
gagggcgcgcgggcgctgggaattaacagcgtgctggtaaccgacagcacaaccgtgccg
gactggtttgcaggtcagcattaa

DBGET integrated database retrieval system