KEGG   Pantoea ananatis PA13: PAGR_g0167Help
Entry
PAGR_g0167        CDS       T01970                                 

Definition
(GenBank) triosephosphate isomerase TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00010  Glycolysis / Gluconeogenesis
paq00051  Fructose and mannose metabolism
paq00562  Inositol phosphate metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
paq01230  Biosynthesis of amino acids
Module
paq_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
paq_M00002  Glycolysis, core module involving three-carbon compounds
paq_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g0167
   00051 Fructose and mannose metabolism
    PAGR_g0167
   00562 Inositol phosphate metabolism
    PAGR_g0167
Enzymes [BR:paq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAGR_g0167
Exosome [BR:paq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAGR_g0167
  Exosomal proteins of bladder cancer cells
   PAGR_g0167
  Exosomal proteins of melanoma cells
   PAGR_g0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AER30707
Position
complement(182710..183477)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTAELIDGLRKELSGVEGCGIAIAPPALYLDQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKTAG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLTTQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcatatgacagcc
gaactgatcgacggtctgcgcaaagaactgtcgggcgttgagggttgtggcatcgctatt
gcaccgcccgcgctctatcttgatcaggctaaacacgccatctccggtagccacatcgct
ctgggtgctcaaaacgttgatgtaaacctctctggcgcatttaccggcgaagtgtccgct
gaaatgctgaaagatatcggcgcgaaatacatcatcattggtcactcagaacgtcgcact
tatcacaaagagagtgacgagttcattgcgaaaaaatatgccgtgttgaaaactgctggc
ctggtgccggttctgtgcatcggtgaaactgaagcggaaaacgaagcgggcaaaaccgaa
gaagtgtgtgcacgccagcttgatgcggtgctgaccacgcagggtgcagaagcgtttaaa
gacgcggtcatcgcttacgagccggtatgggcgatcggtaccgggaagtcagccacacct
gctcaggcgcaggccgttcacaaatttattcgtgaccacattgccaaaaaagatgcggct
atcgctgagcaagtgattattcagtacggcggctcagttaacgataaaaacgctgccgag
ctgtttactcagccggacatcgacggtgccctggttggcggcgcgtcgctgaaagccgat
gcgtttgccgtgatcgttaaagctgctgcggcggctaaacaacgctaa

DBGET integrated database retrieval system