KEGG   Pantoea ananatis PA13: PAGR_g0352Help
Entry
PAGR_g0352        CDS       T01970                                 

Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
paq  Pantoea ananatis PA13
Pathway
paq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAGR_g0352
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paq02022]
    PAGR_g0352
Two-component system [BR:paq02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PAGR_g0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AER30891
Position
400500..401219
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaactacaagattctggtcgtcgatgacgatatgcgtttacgtgcactatta
gagcgctatcttaccgagcagggctttcaggtgcgcagtgtcgccaacgccgagcagatg
gaccgtctgttaacccgcgaatccttccatttaatggtgcttgatctgatgctgcctggc
gaagatggtctttccatttgccgccgcctgcgcagtcagagcaacccgatgcctatcatt
atggtgaccgccaagggcgaagaagtggatcgcatcgttgggctggaaatcggtgctgac
gactatattccaaagccgttcaacccacgtgagctgctggcgcgtattcgtgcggtattg
cgccgtcaggccaatgaactgcccggtgcgccgtctcaggaagaagcggtcatcgctttt
ggcaagttcaagcttaacctgggcacgcgtgagatgttccgtgaagacgaacctatgccg
ttgaccagcggtgaatttgccgttctcaaggcgctggtaagccatccacgtgagccgctg
tcgcgcgataagctgatgaatctggcccgtggtcgggagtacagcgccatggaacgttct
atcgacgtacagatttcccgcctgcgacgcatggtggaagaagatccggcccatccacgc
tacatccagaccgtttggggcctgggctatgtatttgttccggacggcagtaaagcatga

DBGET integrated database retrieval system