KEGG   Pantoea ananatis PA13: PAGR_g1368Help
Entry
PAGR_g1368        CDS       T01970                                 

Definition
(GenBank) histidine transport ATP-binding protein HisP
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
paq  Pantoea ananatis PA13
Pathway
paq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PAGR_g1368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paq02000]
    PAGR_g1368
Enzymes [BR:paq01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     PAGR_g1368
Transporters [BR:paq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PAGR_g1368
   Histidine transporter
    PAGR_g1368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_13 AAA_16 ABC_ATPase PRK DUF87 AAA_33 AAA_23 G-alpha AAA_24 Mg_chelatase RsgA_GTPase NACHT AAA_22 AAA_28
Motif
Other DBs
NCBI-ProteinID: AER31892
Position
1465951..1466724
Genome map
AA seq 257 aa AA seqDB search
MADNKLSVTDLHKRYGEHEVLKGVSLNANAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TIVVNKTAITLVRDTDGQLKVADKEQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKAQARERAITYLNKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPT
SALDPELVGEVLRIMQKLAEEGKTMVVVTHEMEFARHVSSHVIFLHQGKIEEQGPPAELF
GQPKSPRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggctgataacaaattaagcgtcaccgacctgcataaacgttacggtgaacatgaagta
ttaaaaggtgtgtcattgaacgccaatgcgggcgatgtcatcagtattattggctcgtcg
ggttccgggaaaagtacctttctgcgctgtattaacttcctcgaaaagccgagtgaaggc
accattgtggtcaacaagaccgctattaccctggtacgcgatacggacggccagctgaag
gtggcagacaaggagcaactgcgcctgcttcgtacccgtctgaccatggtctttcagcat
ttcaacctgtggagccacatgacggtgctggaaaacgttatggaagcgccgattcaggtg
ctgggcctgagtaaagcgcaggcacgtgagcgcgcgattacctatttgaacaaggtcggc
atcgacgagcgcgcgcagggaaaatatcccgtccatctctcgggagggcagcagcagcgc
gtctccattgcccgcgcgctggcgatggagccggaggtgctgttatttgatgagcccacc
tcagccctggatcctgagctggtcggcgaagtgctgcgtattatgcagaagctggccgaa
gaggggaaaaccatggtggtggtcacgcacgaaatggaatttgcccgtcacgtctccagc
cacgtcattttcctgcatcaggggaaaattgaggagcaggggccaccggctgaattattt
ggtcagcccaagagcccgcgcttacagcagttcctgaagggatcgcttaagtag

DBGET integrated database retrieval system