KEGG   Pantoea ananatis PA13: PAGR_g1583
Entry
PAGR_g1583        CDS       T01970                                 

Definition
(GenBank) hemolysin co-regulated protein Hcp1
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
paq  Pantoea ananatis PA13
Pathway
paq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAGR_g1583
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paq02044]
    PAGR_g1583
Secretion system [BR:paq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAGR_g1583
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AER32107
Position
1735435..1735917
AA seq 160 aa
MAIDIYLKVEGTTGESQDSNHKGWTDVLSFNWGASQPGNMAVGGGGGSGKVNFNDLRVKA
LIDKSTAAILKYCSSGKHVSKVELSVCKAGGNQIEYTKIVLEDVLVTATDFNGVGQGDTI
VVDYAFQASKVSTSYWEQSASGTKGAESKAGWDIKQNKES
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcgattgatatttatttgaaagttgaagggactactggagaatcacaggacagcaat
cataaaggatggaccgacgtgctctcatttaactggggggcttcgcaacccggtaatatg
gcggtaggtggcggtggcggctcaggaaaagtgaatttcaacgatctgcgtgttaaagcg
ttaatcgacaaatccactgctgccattcttaaatactgctccagcggaaagcatgtttca
aaggtagaactgtcggtttgcaaagccggtggcaaccaaattgagtacacgaagattgtg
ctggaagatgtactggttacggcaacggattttaacggagtagggcaaggtgacaccatt
gtggtggactacgcctttcaggcatccaaagtgtctaccagctactgggaacaaagtgcc
agcggtaccaaaggggcggaaagcaaagctggttgggatattaaacaaaataaagagagc
tga

DBGET integrated database retrieval system