KEGG   Pantoea ananatis PA13: PAGR_g1647Help
Entry
PAGR_g1647        CDS       T01970                                 

Definition
(GenBank) hypothetical protein
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAGR_g1647
Enzymes [BR:paq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     PAGR_g1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2
Motif
Other DBs
NCBI-ProteinID: AER32170
Position
1807086..1807778
Genome map
AA seq 230 aa AA seqDB search
MQRSEVNVFLQNTRDFFTRQDINLPPWADYDLSQWRQQQGDIEEIIALRLGWDLTSFGAD
DFLQTGLTLFTLRNGSPGGKPWHKPYAEKVMHVREGQVTPMHYHPRKMEDIINRGGGNLI
VELYNREGNEKANSPVTVSLDGITQTHAAGSQLRLSPGESVTLIAGVWHSFWGENSFGDV
LVGEVSMPNDDDNDNVFLTPLARFNALDEDQEPHRLLCNDYSHWLNLRSE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgctccgaagtgaatgtgtttttgcaaaacacgcgggacttttttacacgccag
gatatcaatctgccgccctgggctgattacgacctcagtcagtggcgtcagcagcagggc
gacattgaggaaattatcgcgttacggctgggctgggacctcaccagctttggcgccgat
gattttctgcaaaccggcctgacgctctttacgctgcgcaacggctcgccgggcggcaag
ccctggcacaaaccttatgctgaaaaagtcatgcacgtgcgtgaagggcaggtcacgccg
atgcattatcatccccgtaaaatggaagacatcatcaaccgcgggggcggcaatctgatc
gtcgaactgtataaccgtgaaggcaatgagaaggcgaactcgccggtgacggtatcgctg
gatggcatcacacaaacccatgcggccggttcgcaactcaggctgtctccaggcgaaagc
gtgacgttaatcgccggcgtctggcacagcttctggggcgaaaacagctttggcgatgtg
ctggttggcgaagtctcgatgcctaacgatgatgacaacgataacgtatttttgacgccg
ctggcgcgctttaacgcccttgatgaggatcaggaaccgcaccggctgctctgtaacgac
tattcccactggctcaatctgaggagtgaataa

DBGET integrated database retrieval system