KEGG   Pantoea ananatis PA13: PAGR_g1664
Entry
PAGR_g1664        CDS       T01970                                 

Definition
(GenBank) type VI secretion system effector protein hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
paq  Pantoea ananatis PA13
Pathway
paq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAGR_g1664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paq02044]
    PAGR_g1664
Secretion system [BR:paq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAGR_g1664
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AER32187
Position
1829513..1829995
AA seq 160 aa
MAIDMYLKVDGITGESKDSNHTGWIDITSFSWGANQPGNMSVGGGGGAGKVNFNDLHINA
KIDKAVTALLKNCASGKHVTKVEVSVCKAGGTQIEYTRITLEDVLVTNVQFVGSEHDDTL
GVTYAFQAAKVKQQYWEQSSSGGKGAESSAGWNIKENKEA
NT seq 483 nt   +upstreamnt  +downstreamnt
atggctattgatatgtatttgaaggtagacggtattactggtgaatctaaagattcaaac
cataccggctggattgatattacctctttctcctggggcgctaatcagccgggtaatatg
agcgtgggcggcggcggcggtgctggtaaagtaaacttcaacgacctgcacattaatgcc
aaaatcgacaaggctgtcactgcgctgttgaaaaactgtgccagtggtaagcacgtcact
aaggttgaagtttcagtttgcaaggctggcggtacgcaaatcgagtatacccgcatcacc
ctggaagacgtgctggtcaccaacgtacagttcgtgggctctgagcacgacgataccctg
ggcgtgacctatgcattccaggctgcgaaagtgaaacagcagtactgggagcagagctct
tccggtggcaaaggcgcagaaagcagcgctggctggaatatcaaagagaataaagaagcg
taa

DBGET integrated database retrieval system