KEGG   Pantoea ananatis PA13: PAGR_g1667
Entry
PAGR_g1667        CDS       T01970                                 

Definition
(GenBank) FHA domain-containing protein
  KO
K07169  FHA domain-containing protein
Organism
paq  Pantoea ananatis PA13
Brite
KEGG Orthology (KO) [BR:paq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    PAGR_g1667
SSDB
Motif
Pfam: FHA UreE_N
Other DBs
NCBI-ProteinID: AER32190
Position
1832272..1834167
AA seq 631 aa
MRFTIITAKPGHEPPQISFDFLPPGGTIGRGVDNNLILPDDDRTISRLQAIVHITAEGEC
RLTNRGNVTRVLLNDIPLERGRQVELQDGDILGIDDYRLLVNDLNGEQQSQQPPLTAAAA
PKQQPVPNAVPVQAPAASTAAIPSEIWDSLAKEFSISDDLSKRKSAAQEMPEANPLTSTA
ANRNPEDPLAQLMSDKPLDIGQQPKTSSLFDEEDALFAQESIFDDRTPSTLSAKQNAQGQ
PKIEETSTDVDPLNLFGSQTTPDPRHHDDPLGLMMSGAVPLAQPDMPVSQPVAAPSQPKE
NHQSAPLQQKEPHQAAPLQQKPHHQPMPDILDTAPVELADLSSSPLFDHTETQVTHDPAF
DPQPQPAQPEGAQSPIDYGGITLPTPQAVQRTPSPTPKGRLRIDPVASHNNSGGTEQSGN
ASSGDALKGELLDALLEGMGLQDLQPTPQFDREQMRQFGQMLSMFSQGTVALLSSRSILK
RGVKADMTVILDDANNPFKLLPSGKTVLMQMFGSRMPGFMPPRQAVRDALIDLQAHQLGM
IAGIRAIIASMLQSFNPDQLEEEARQNGSVSRIGLPGSRKAALWEHFIQRYGETAGEIED
DFHTLFGEAFLHAYDMEVNQYKDSQTHTDDA
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgcgctttacgataataaccgctaaacccggccatgaaccgccgcaaatcagtttcgat
tttcttcctccaggcggcactattggtcgaggcgtggataataatctgatattgcccgac
gacgatcgcactatttctcgcctgcaggctatcgtgcatattactgcagagggtgaatgt
cgcctgaccaaccgcggtaacgttacgcgcgtgctgctgaatgacatcccgcttgaacgt
ggacgtcaggtggagttgcaggacggagatattctcggcatcgacgactatcgtctgctg
gttaacgatcttaatggcgagcagcaatcgcagcagcctccgttgaccgctgcagccgca
cctaagcagcagcccgtacccaatgcggtccctgtacaggcgccggctgccagcacggct
gccattcccagcgagatctgggacagccttgccaaagagttttcaatttctgatgattta
tcgaaacgtaaaagtgctgcgcaagaaatgccggaggcaaatccgttaacctctacagca
gcaaaccgtaatcccgaagatccgctggctcagttaatgagcgataaaccgctggatatc
ggtcagcaacctaagacaagcagcctgtttgatgaagaggatgcactgtttgctcaggaa
agcatttttgatgaccgcacgcccagcaccttgtcggcaaaacaaaatgcgcaagggcag
cccaaaatagaggaaacctccacagacgtggacccgttaaatctgtttggcagccagacc
acgccggacccgcgtcatcatgacgatccgctggggttaatgatgagcggtgccgtgccg
ctggctcagccagatatgccggtttcgcaacctgtggctgcgccatcgcagccgaaagaa
aaccatcagtctgcacccttgcagcagaaagagccccatcaagcggcgccattacagcag
aaacctcatcaccagccgatgcctgatatcctggatactgcaccggttgagttggctgat
ttaagcagttcaccgctgtttgatcacactgaaacgcaggtcactcacgatcccgctttc
gatcctcaaccgcagcctgcccagcctgaaggagcgcaaagcccgattgattacggcggc
attaccttgccaacaccgcaggcggtgcaacgcacgccttcgcccacgccaaaagggcgg
ctgcgcatcgatccggttgcctcgcacaataacagcggtgggaccgagcagagtggcaat
gccagtagcggtgatgccttaaagggcgagttgctggatgcactgctggaaggtatgggc
ctgcaggatctgcaaccgacaccgcagttcgatcgtgagcagatgcggcagttcggccag
atgctcagcatgttctcgcagggaacggtggcactgctgtcttcccggtcgattttaaaa
cgcggtgtaaaagccgacatgaccgtgatcctggatgatgctaacaacccgtttaagctg
ctgccgtcaggtaaaaccgtattgatgcagatgtttggcagccgtatgccaggttttatg
ccgccacgccaggccgtgcgtgacgcactgattgacctccaggcgcaccagttagggatg
attgccggtattcgcgccattattgcttccatgctgcagtcctttaaccccgatcagctc
gaagaagaagcgcgtcaaaacggttccgtatcgcgcattggactacccggcagccgtaaa
gccgcgctgtgggagcattttatccagcgctatggcgaaactgccggtgaaattgaagat
gacttccataccttgtttggcgaagccttcttgcacgcgtacgacatggaagtaaatcag
tataaagactcacaaacccacacggatgacgcatga

DBGET integrated database retrieval system