KEGG   Pantoea ananatis PA13: PAGR_g1670
Entry
PAGR_g1670        CDS       T01970                                 

Definition
(GenBank) putative type VI secretion system-associated protein
  KO
K11898  type VI secretion system protein ImpE
Organism
paq  Pantoea ananatis PA13
Brite
KEGG Orthology (KO) [BR:paq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paq02044]
    PAGR_g1670
Secretion system [BR:paq02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PAGR_g1670
SSDB
Motif
Pfam: ImpE TPR_19
Other DBs
NCBI-ProteinID: AER32193
Position
1835981..1836808
AA seq 275 aa
MDSLQQRLANATLAENLSSITAQIQANPADADLRAAFVQLLCLDGNWSRAQTQLKSWLAM
LPQAQPTVTLLQQAIEGEQKRAAVLRGEAEPQLPGSAWPWCQVLLAALKADIAGDKAVGA
ALRAQALESAEASAGTATTQEGESPFAWIMDGDSRFGPVCEAIANGHYYWIPFAAISEIE
FQAPASVTDLVWRHTRLQLVDGSEQICQIPVRYPLQDKADERFLRASVTEWQESGSDDGQ
FIGHGQKMWLSDEADYPLLTLQQLIFNETELPHES
NT seq 828 nt   +upstreamnt  +downstreamnt
atggactcactacaacagcgactggccaatgccaccctggcggaaaacctgtccagcatc
actgcacaaatccaggcgaatccggctgatgcggatttacgggcggcatttgtgcaactc
ctgtgccttgacggtaactggagcagggcgcagacacagctgaaatcctggctggccatg
ctgcctcaggcgcagcccaccgtgaccttgctgcaacaggccattgagggcgaacagaaa
cgtgcagcggttttgcgcggtgaagccgagccgcaactgccaggaagcgcctggccgtgg
tgccaggtcttactggccgcgctgaaagcggacatagcgggcgataaggccgtcggtgcg
gcactgcgtgctcaggcgctggaaagcgcagaggcgagcgccggtacggccacaacccag
gagggggaaagcccgttcgcctggataatggacggtgacagccgcttcggaccggtctgt
gaagccatcgccaatggacactattactggatcccgtttgctgccatcagcgaaatagag
tttcaggctccggcaagcgtcacggatctggtctggcgccatactcgcctgcagctggtg
gacggaagtgagcaaatttgtcagattccggtgcgctacccgcttcaggacaaggctgat
gaacgcttcctgcgggcaagcgtaacggagtggcaggaatcaggcagcgatgacggtcag
tttatcggtcacgggcaaaagatgtggctcagcgatgaagcagattatcccttactgacg
ctgcagcagcttattttcaacgaaactgagttacctcatgagtcgtaa

DBGET integrated database retrieval system