KEGG   Pantoea ananatis PA13: PAGR_g1673
Entry
PAGR_g1673        CDS       T01970                                 

Definition
(GenBank) type VI secretion system protein ImpH
  KO
K11895  type VI secretion system protein ImpH
Organism
paq  Pantoea ananatis PA13
Brite
KEGG Orthology (KO) [BR:paq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paq02044]
    PAGR_g1673
Secretion system [BR:paq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAGR_g1673
SSDB
Motif
Pfam: T6SS_TssG OGG_N
Other DBs
NCBI-ProteinID: AER32196
Position
1839250..1840299
AA seq 349 aa
MSETAHVIPLQRAVRLPDGFWQAVMAAPWRYDLFQLLRKLDAQSGQRYALGKAPLPKFEA
VRIGQKPSLAFAPSTVSQVKAREQDERYDVSIYSFGLFGPNGPLPTHLTEYVRGRIDHHQ
DHSLSAFADLFHHRATLLFYRAWANSQPTSSLDRRDDRRFQDYLACVAGIGLPAQQKASS
LSLHARLMLSGHLSRHGHDAEGLVRILRHYFAVPVKLQQNVPQWLSLDSRDQARLSAGRH
MPRLGESAFLGVAVRDVQHRFRLRIGPLSAEQYERFLPNAQGACEVRDWVRHYLGIEMQW
DLSLILAADAVKGLTLGGQARLGYTSWLGQQPQPVDREDFAFEVEATPS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagtgagacggcgcacgttattcccctacagcgggcggtgcgtctgcctgacggtttc
tggcaggccgtgatggccgcgccctggcgctatgatctgtttcagttgttacgcaagctg
gacgcccagagtgggcagcgttatgccttaggtaaagcgccactgcccaaatttgaagcc
gtgcgtattgggcaaaagccatccctggcctttgcaccatcgaccgtgtcacaggttaaa
gcgcgtgagcaggacgaacgctacgacgtctccatttacagctttgggctgtttggtccc
aacggtcctctccctacgcacctgacggaatatgtacgcggacgtatcgatcaccatcag
gatcacagcctgagcgctttcgccgatctgtttcatcatcgtgccacgctgctgttctac
cgtgcctgggctaattcacagccaaccagctccctggatcgccgcgacgatcggcggttt
caggattatctggcctgcgtggccggtattgggttaccggcccagcagaaagccagttcg
ctgagtctgcatgcgcgcctcatgctgtcagggcatctcagccgccacggtcacgatgcc
gaagggctggtacgcattttgcgtcactactttgccgttccggttaagctgcaacagaac
gtgccgcagtggttatccctggacagccgcgatcaggcccgtctgtcggccggtcgccat
atgccgcgcctgggtgaatcggcctttctcggtgtggccgttcgtgatgtacagcatcgt
tttcgtctgcgcatcggtccactgagcgccgagcagtacgaacgttttttacccaacgcg
cagggcgcttgcgaagtgcgtgactgggtgcgccactatctgggtattgagatgcagtgg
gatctcagcctgattctggcagccgatgccgttaagggcttaacccttggcggtcaggcg
cggctgggctacaccagttggcttggacagcaaccgcagcctgtcgatcgtgaagatttt
gcctttgaggttgaagctacgccgtcatag

DBGET integrated database retrieval system