KEGG   Pantoea ananatis PA13: PAGR_g1676Help
Entry
PAGR_g1676        CDS       T01970                                 

Definition
(GenBank) putative type VI secretion system effector protein VgrG
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
paq  Pantoea ananatis PA13
Pathway
paq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAGR_g1676
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:paq02044]
    PAGR_g1676
Secretion system [BR:paq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAGR_g1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Gp5_C Nsp3_PL2pro
Motif
Other DBs
NCBI-ProteinID: AER32199
Position
1844467..1846710
Genome map
AA seq 747 aa AA seqDB search
MFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDG
LLSAVNPRYINGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVPQI
VQTLLKEYGVNVETRLAGSYRVWEYCVQYQESSFDFISRLMELEGIYYFFRHEADKHTLV
LCDAPDQHQAFPGYETIAYHVTPSGGSVTEEGVSQWALSESVTPGMYSTDDYDFRKPNAW
MLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQEVWQVEHHMVSGSGTATGIAP
GYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTVLPAAVTYRAKPE
TPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWDLPGDATRMGFMTRSKDGHQ
ANASYLFFEDKPGGELLNMHAEKDMNISVENDKTVAIDGSRTTTIGKEQNDEVTGDATFH
YKQKRTITVDQLESKNFNNGESVKVKNGRKTIISSGGSHSEVTGDKFLKLDGHFSRKISG
NDEEHIKGSRAATIDNGDTLTITNGGLNVNVNGLWHQSATAGVKIESPQDITIKSSTKVF
IDSPVFERNDVQKNSFAQDAMDFISKYVSFSVGSVAFKGVNYGMTGVNISHQGFAFGRTI
INAQRVEAARVDSGSLRTALFALHMIM
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgttctcacgtattactgtacaacttcccgcacaaggactgctgttccgacgtctgagc
ggcagcgaagcgctgtcccagtcgttcgtgctgcaagcggagctgctctccaccgacgcg
cgcattgatcgtaagtcgttgctgggcaagccggtcactttcacgctgccgacggatggt
ctgctgagcgcggtgaatccgcgctacatcaacggcaaaattactcagataggcgtgcgc
agcgaggagctgggcggcgtgcgctacgccgtttacgggctgacggtggagtcggatctg
tggccgatgaagcgcgaccgcaacctgcgcatcttccagagccagacggtgccgcagatt
gtgcagacgctgctgaaggagtacggagtgaacgtggaaacgcgcctggcgggcagttac
cgggtgtgggaatactgcgtgcagtatcaggagagcagcttcgactttatcagccggctg
atggagctggaggggatttactacttcttccgtcacgaggcggacaagcacacgctggtg
ctgtgtgacgcgccggaccagcaccaggcgttcccgggctacgaaaccatagcctaccac
gtgacgccgtcgggcggcagcgtgacggaagagggcgtgagccagtgggcgctgtcggaa
agcgtgacgccggggatgtacagcacggacgactacgacttccgcaagccgaacgcgtgg
atgctgcaggcgcggcagaacccggtgtcgccgaccccgggctcggtggacgtgtacgac
tggccgggtcgcttcgtggagcacggtcacggcgaatactacgcgcgtatccgccaggag
gtgtggcaggtggagcaccacatggtgagtgggagcggcacggcgacgggcatcgcgccg
ggctacactttttcgctgctgaacgcgccgcacttcagcgacaacggcaaatacctggtg
acgtcggcgcactacgactttgaagagaacagctacgcgagcggcgacgtgggcgccacg
cggcacaacatcgacttcacggtgctgccggcggcggtgacgtaccgtgcgaagccggag
acgccgtggccgaagacgcacggcccgcagacggcgaaggtggtggggccgaaaggcgag
agcatctggacggacaaatacggccgggtgaaggtgaagttccactgggaccgtctggcg
aagggtgacgacacgagttcgtgctgggtgcgcgtatcgagtgcctgggcgggtcagggc
ttcggcggggtgcagatcccgcgcgtgggcgatgaagtcgtcgtcgattttatcaacggc
gatccagaccggccaattattactggccgtgtctacaacgaagccagcatgccaccctgg
gatctccccggcgatgctacacgaatgggctttatgacacggagtaaagacggacatcag
gccaatgccagctatctgttctttgaagataagccgggcggtgaactgctgaatatgcat
gctgagaaagacatgaatatttcggtggagaatgataagaccgttgccattgatggatcc
cggaccaccactattggcaaagagcagaatgacgaagtaacaggtgatgcgacttttcat
tacaaacaaaagcggacgataacagttgaccagctcgagtcaaaaaattttaataacggt
gaaagtgttaaagtaaaaaatggtcgcaaaaccatcatttctagtggtgggagccacagt
gaagtaacaggtgataagtttttaaaactcgacggccatttttccagaaaaataagtggc
aacgatgaagaacacattaaaggtagcagagcggccactatagataacggtgatacacta
accattacaaatggaggacttaatgttaacgtaaatggcttatggcatcagagtgcaacc
gcaggtgtgaaaattgaatcgccgcaagatattactataaaaagtagtactaaagttttt
attgattcacctgtttttgaaagaaacgatgtccaaaaaaatagctttgcacaagatgca
atggattttattagtaagtatgtttcattttcggtaggaagtgtggctttcaaaggtgtc
aactatggcatgacaggtgtgaatatatcacatcaagggtttgctttcggtcggaccatc
attaatgctcaaagagttgaagccgctcgtgttgacagtggaagcctgaggacagcattg
tttgctctccacatgattatgtaa

DBGET integrated database retrieval system