KEGG   Pantoea ananatis PA13: PAGR_g1684
Entry
PAGR_g1684        CDS       T01970                                 

Definition
(GenBank) putative type VI secretion system effector protein VgrG
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
paq  Pantoea ananatis PA13
Pathway
paq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:paq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PAGR_g1684
Secretion system [BR:paq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PAGR_g1684
SSDB
Motif
Pfam: Phage_GPD Glucosaminidase Phage_base_V bCoV_SUD_C
Other DBs
NCBI-ProteinID: AER32207
Position
1853204..1855693
AA seq 829 aa
MFSRITVQLPAQGLLFRRLSGSEALSQSFVLQAELLSTDARIDRKSLLGKPVTFTLPTDG
LLSAVNPRYINGKITQIGVRSEELGGVRYAVYGLTVESDLWPMKRDRNLRIFQSQTVPQI
VQTLLKEYGVNVETRLAGSYRVWEYCVQYQESSFDFISRLMELEGIYYFFRHEADKHTLV
LCDAPDQHQAFPGYETIAYHVTPSGGSVTEEGVSQWALSESVTPGMYSTDDYDFRKPNAW
MLQARQNPVSPTPGSVDVYDWPGRFVEHGHGEYYARIRQEVWQVEHHMVSGSGTATGIAP
GYTFSLLNAPHFSDNGKYLVTSAHYDFEENSYASGDVGATRHNIDFTVLPAAVTYRAKPE
TPWPKTHGPQTAKVVGPKGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQG
FGGVQIPRVNDEVVVDFINGDPDRPLIIGRVYNEASMPPWALPAAATQMGFLSRSKDGTA
DTANALRFEDKAGEEHLWIQAQKNMDTHVKNDSSHSVANNHSHYAGGNELYRVETNRVHG
VKGGEERLTGQGKIDNVVDTYVLGSGTKLRLECGESAIELNANGHINIVGKGFNLFVNGD
GHITTSGGKLNLNTSGAQPGTGAPGAGHKGNINQAVVNLFPPKQKGQAAPAAPKAKVEHA
KSPSTPVNNKTEKKVRPLPPEKQAFFDKVYAAAQADEKKTGVPAQVTTAQAILESDWGKR
VPTDVNTNKVSNNLFGVKAHGSPNYVESWTHENINGKRVPVLDKFASYDSVDESIEQHSQ
FLIKNQRYSSLFQSSDPVEWAKGLQDKGYATDPNYAKSLISVMKGRGLL
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgttttcacgtattacagtccagttacccgcacaaggactgctgttccgacgtctgagc
ggcagcgaagcgctgtcccagtcgttcgtgctgcaagcggagctgctctccaccgacgcg
cgcattgatcgtaagtcgttgctgggcaagccggtcactttcacgctgccgacggatggt
ctgctgagcgcggtgaatccgcgctacatcaacggcaaaattactcagataggcgtgcgc
agcgaggagctgggcggcgtgcgctacgccgtttacgggctgacggtggagtcggatctg
tggccgatgaagcgcgaccgcaacctgcgcatcttccagagccagacggtgccgcagatt
gtgcagacgctgctgaaggagtacggagtgaacgtggaaacgcgcctggcgggcagttac
cgggtgtgggaatactgcgtgcagtatcaggagagcagcttcgactttatcagccggctg
atggagctggaggggatttactacttcttccgtcacgaggcggacaagcacacgctggtg
ctgtgtgacgcgccggaccagcaccaggcgttcccgggctacgaaaccatagcctaccac
gtgacgccgtcgggcggcagcgtgacggaagagggcgtgagccagtgggcgctgtcggaa
agcgtgacgccggggatgtacagcacggacgactacgacttccgcaagccgaacgcgtgg
atgctgcaggcgcggcagaacccggtgtcgccgaccccgggctcggtggacgtgtacgac
tggccgggtcgcttcgtggagcacggtcacggcgaatactacgcgcgtatccgccaggag
gtgtggcaggtggagcaccacatggtgagtgggagcggcacggcgacgggcatcgcgccg
ggctacactttttcgctgctgaacgcgccgcacttcagcgacaacggcaaatacctggtg
acgtcggcgcactacgactttgaagagaacagctacgcgagcggcgacgtgggcgccacg
cggcacaacatcgacttcacggtgctgccggcggcggtgacgtaccgtgcgaagccggag
acgccgtggccgaagacgcacggcccgcagacggcgaaggtggtggggccgaaaggcgag
agcatctggacggacaaatacggccgggtgaaggtgaagttccactgggaccgtctggcg
aagggtgacgacacgagttcgtgctgggtgcgcgtatcgagtgcctgggcgggtcagggc
ttcggcggggtgcagatcccgcgcgtcaacgatgaggttgtcgtggacttcatcaatggc
gatccagatcgtccgttgatcattggccgcgtttataacgaagccagtatgccgccatgg
gcactaccggctgccgccacacaaatgggctttctgagtcgctcgaaagacggcactgcg
gataccgcgaacgcattacgctttgaggataaggcgggcgaggagcatttgtggatccag
gcgcagaagaacatggatacacatgttaaaaatgattccagccattccgttgccaacaac
cacagccactatgcaggcggtaacgaactctatcgcgttgaaaccaaccgtgtacatggc
gtgaaaggtggagaagagcgtttaacgggacaagggaaaatcgacaatgttgttgatacc
tatgtactgggctcaggtactaagttacggcttgaatgtggcgaaagcgctatcgaactt
aatgctaatggtcatatcaatattgtcggtaagggcttcaatctgtttgtgaacggtgat
ggacacatcactacatcaggcggaaaactcaatttaaatacatccggtgcgcagccgggt
acgggtgcacctggtgctggccacaaaggcaacatcaatcaggccgttgtgaatcttttc
cccccaaagcaaaaggggcaggcggccccggcagcacctaaagcgaaggttgagcatgcg
aaatccccttccacaccagtaaacaataaaactgaaaagaaagtgcggccgttacctccc
gaaaaacaagccttttttgataaggtgtacgccgcagctcaagctgatgagaaaaagaca
ggcgtccctgcacaggtaacaactgctcaagccatattggaatctgactggggaaagaga
gtgccgactgacgttaataccaataaggtcagtaataatctttttggggtaaaagcacac
ggctcgccaaattatgtggaatcatggactcatgaaaacataaatggcaaacgagtacct
gttttagacaaattcgcgagttatgactcagtagatgaaagtattgaacagcattctcaa
tttttgattaaaaatcagaggtatagtagtttgtttcagtcatcggatcctgttgagtgg
gccaaaggattacaggataaaggctatgcaacggatcccaactatgctaaaagcttgatt
tcagtaatgaaaggtagaggcctcctatga

DBGET integrated database retrieval system