KEGG   Pantoea ananatis PA13: PAGR_g2944Help
Entry
PAGR_g2944        CDS       T01970                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase BioF
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00780  Biotin metabolism
paq01100  Metabolic pathways
Module
paq_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:paq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAGR_g2944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:paq01007]
    PAGR_g2944
Enzymes [BR:paq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     PAGR_g2944
Amino acid related enzymes [BR:paq01007]
 Aminotransferase (transaminase)
  Class II
   PAGR_g2944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AER33440
Position
complement(3192359..3193510)
Genome map
AA seq 383 aa AA seqDB search
MSWQQRIQQALIQRRAEDGWRERRVIEENQTRLIRHAGQTFRHFSSNDYLGLSQHPAVMA
GWQQGVDEAGAGAGASGHVTGFHRLHAELEAQLADWLGYSRALLFISGFAANQAVIHLLA
EKNDRILADKLTHASLLEAASQSPAQLRRFTHNDPLSLAKRLDAPCEGQTLVVTEGVFSM
DGDSAPLQAIADRAKHAGACLLVDDAHGIGVTGEQGRGSCWAQGMKPDLLVVTFGKAFGV
SGAALLCDEATADYFVQFSRHLIYSTAMPPAQASALLASLKQVQAGDDRRQRLARNIAHF
RHGAASLPWQLMASSSAIQPLIVGDNGEALALSARLARAGCWVSAIRPPTVPPGTARLRI
TLTAVHEPEDIDALLEALYDAAG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagcaacgcatccagcaggcgctgatacagcgccgtgctgaagatggctgg
cgcgaacggcgcgtgatagaagagaatcagacgcgcctgatccgccatgccggtcagacc
tttcgccatttctccagtaacgattatcttgggctgagccagcatcccgccgtcatggcg
ggctggcaacaaggcgtggacgaggccggtgccggtgcgggtgcatcgggccatgtaacc
ggttttcatcgtttacatgccgagctggaagcacagctggcagactggctgggctattcg
cgcgcgctgctgtttatttccggctttgcagcgaatcaggcggtgattcacctgctggca
gagaaaaatgaccgcattctggccgacaaactgacgcatgcttcgctgctggaggccgcc
agccaaagccctgctcagctgcgccgctttacccataacgatcctctcagtctggctaag
cgcctcgatgcgccctgcgaagggcaaacgctggtggtaaccgaaggggttttcagtatg
gacggcgacagcgcgccccttcaggcgatcgccgaccgggcgaaacatgccggtgcctgt
ttgctggtcgatgatgcgcacggcataggggtgacgggcgagcagggacgtggcagctgt
tgggcacagggcatgaaacccgacctgctggtggtgacctttggcaaagcctttggcgta
agcggggccgcgctgttgtgtgatgaggcgaccgccgattactttgtgcaattttcccgt
catctgatttactccacggcgatgccgccagcccaggccagtgcgctgttagcgtcgctg
aaacaggtgcaggcgggtgatgaccgccgtcaacgtctcgcgcgtaatatcgcccatttc
cggcacggcgcggcctcgttgccctggcaacttatggcgtcgtccagcgccattcagcca
ttaatcgtcggggataacggcgaggcgctggcgctgtctgcgcgcctggccagggcgggc
tgctgggtcagtgcgatccgtccgccgaccgtgccgccgggcacggcccgtctgcgcatc
acgcttaccgccgtccatgagccagaggatattgatgccctgctggaggcgctgtatgac
gctgcaggttga

DBGET integrated database retrieval system