KEGG   Pantoea ananatis PA13: PAGR_g2982Help
Entry
PAGR_g2982        CDS       T01970                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain SucC
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00020  Citrate cycle (TCA cycle)
paq00640  Propanoate metabolism
paq00660  C5-Branched dibasic acid metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
Module
paq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAGR_g2982
   00640 Propanoate metabolism
    PAGR_g2982
   00660 C5-Branched dibasic acid metabolism
    PAGR_g2982
Enzymes [BR:paq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PAGR_g2982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AER33478
Position
complement(3231942..3233108)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIDQELYLGAVVDRATRR
VIFMASTEGGVEIEKVAEETPHLIHKMALDPLTGPQPYQGRELAFKLGLTGKQVSQFTKI
FMGLATMFLERDLAMVEINPLVITKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDP
REAHATQWELNYVALEGNIGCMVNGAGLAMGTMDIVKHHGGQPANFLDVGGGATKERVTE
AFKIILSDDAVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQRVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaataccaggctaaacagctgtttgcacggtatggcatgccagcaccg
accggctacgcctgtactacaccacgtgaagcagaagaagcggcatcgaaaatcggtgca
ggcccgtgggtagttaaatgtcaggttcatgccggtggccgcggtaaagcgggcggtgtg
aaagtggttaacagcaaagaagacatccgtgctttcgctgaaaactggctgggcaaacgt
ctggtgacctaccaaactgacgccaatggtcagccggtaaaccagattctggttgaagcg
gcaaccgatatcgatcaggagctgtacctgggtgccgtggttgaccgtgcaacccgtcgc
gtcatctttatggcatcgaccgaaggcggcgtggaaatcgagaaagtggcagaagaaacg
ccacacctgatccacaaaatggcgcttgatccactgaccggtccacagccttatcagggc
cgtgagttagcctttaaactgggcctgaccggtaagcaagtcagccagttcaccaaaatt
ttcatgggtctggccaccatgttcctggagcgcgatctggcgatggttgagatcaacccg
ctggtgatcaccaagcagggcgacctgatctgtctggatggcaaactgggtgctgatggc
aatgccctgttccgtcagccagagctgcgtgaaatgcgcgatccaagccaggaagatcct
cgtgaagcgcacgcgacacagtgggaactgaactatgttgcgctggaaggcaacatcggt
tgtatggttaacggcgcaggcctcgcgatgggtacgatggacatcgttaagcaccacggt
ggccagccagcgaacttcctggatgtcggcggcggcgcgaccaaagagcgcgtaaccgaa
gcctttaaaatcatcctgtctgacgacgcggtgaaagcggtattcgttaacatcttcggc
ggcatcgtgcgttgcgacctgatcgcagacggcatcatcggtgcagtagcagaagtcggt
gttaacgtaccggtcgtggtacgtctggaaggtaacaacgctgaactgggcgctaagaaa
ctggcggacagtggtctgaacatcattgcagcaaccagtctgacagacgcggcacagcgt
gttgttgctgctgcggagggtaaataa

DBGET integrated database retrieval system