KEGG   Pantoea ananatis PA13: PAGR_g4041Help
Entry
PAGR_g4041        CDS       T01970                                 

Definition
(GenBank) isocitrate lyase AceA
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00630  Glyoxylate and dicarboxylate metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01200  Carbon metabolism
Module
paq_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAGR_g4041
Enzymes [BR:paq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PAGR_g4041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AER34526
Position
complement(4400579..4401880)
Genome map
AA seq 433 aa AA seqDB search
MTRTQHIQQLEKQWQDARWQGITRPYSAEEVINLRGSVVPACTLAERGAVKLWSLLNGDA
KKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANVAGQMYPDQSLYPVNSVPEVV
TRINQTFQRADQIQWANGTEPGDSRYIDYFLPIVADAEAGFGGVLNAFELMKSLISAGAA
AVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTILLARTDADAADLI
TSDCDEYDRPFIRGERTAEGFFRTNAGIEQAISRGLAYAPYADVLWCETSTPDLAMAQRF
ADAIHARYPGKLLAYNCSPSFNWKKNLDDKTIAAFQQALSDMGYRFQFITLAGIHSMWFN
MFDLAHAYAQGEGMRHYVEKVQQPEFAARERGYSFSSHQQEVGTGYFDQVTNTIQGGKSS
VTALTGSTEEHQF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactcaacatattcagcaactcgaaaaacagtggcaggacgcgcgctggcag
ggcattacccgcccgtacagcgcagaggaagtgattaacctgcggggctctgttgtgccg
gcctgtactctggcagagcggggggcggtgaagctctggtcgctgctcaatggcgacgcc
aaaaaaggctatatcaacagtctgggagcattaacgggcggtcaggctctgcaacaggca
aaggccggtatagaagcgatctacctgtctggctggcaggtcgctgctgatgccaacgta
gcagggcaaatgtatccggatcagtcgctttatccggtcaactccgtgcctgaggtggtc
acccgtattaatcagacattccagcgcgccgatcagattcagtgggctaacggcacagaa
ccgggagacagccgctatatcgactattttctgcccattgttgccgatgcagaagcgggc
tttggtggcgtgctgaatgcgtttgaactgatgaagtcattgatcagcgcaggcgcggcg
gccgtgcactttgaagatcaactggcggcggtgaagaaatgcggtcatatgggcggtaag
gtgctggtgccaacccaggaggcgatacagaagctggtggcggcgcgtctggctgccgat
gtcatgggcgtacccacgatcctgctggcgcggaccgatgcggatgctgcagacctgatc
acgtctgactgtgacgaatacgaccgcccatttatacgcggcgaacgcacggcggaaggt
tttttccgcaccaacgccggcattgagcaggcaatcagccgtggactggcttacgcccct
tacgccgatgtcctttggtgtgaaacctccaccccggatttggccatggcccagcgtttt
gccgatgcgattcacgcccgctatccaggcaagctgctggcttacaactgttcgccttcg
tttaactggaaaaagaatctggatgacaaaaccattgcggccttccagcaggcgctcagt
gacatgggctatcgctttcagttcattacgctggcgggcatccacagcatgtggttcaac
atgttcgatcttgcgcacgcttacgctcagggcgaaggtatgcgccactatgtggaaaaa
gttcagcagccggagtttgctgcgcgcgaacggggttacagcttttcatcgcatcagcag
gaggtcggaacaggctatttcgatcaggtgaccaacacgattcagggcggcaagtcatcg
gtgacggccctgacagggtccaccgaggagcatcagttttga

DBGET integrated database retrieval system