KEGG   Psychrobacter arcticus: Psyc_0088Help
Entry
Psyc_0088         CDS       T00256                                 

Gene name
argH
Definition
(GenBank) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
par  Psychrobacter arcticus
Pathway
par00220  Arginine biosynthesis
par00250  Alanine, aspartate and glutamate metabolism
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01130  Biosynthesis of antibiotics
par01230  Biosynthesis of amino acids
Module
par_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:par00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Psyc_0088 (argH)
   00220 Arginine biosynthesis
    Psyc_0088 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:par04147]
    Psyc_0088 (argH)
Enzymes [BR:par01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Psyc_0088 (argH)
Exosome [BR:par04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyc_0088 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-ProteinID: AAZ17962
UniProt: Q4FVJ6
Position
complement(101502..102875)
Genome map
AA seq 457 aa AA seqDB search
MWGGRFSEATDSFVAAFTASVGFDQRFARHDIQGSIAHATMLKECSILEADDVATIIDGL
QQVLREIEAGEFNWSIALEDVHMNVESRLTDIVGAVGKKLHTGRSRNDQVATDIRLWLRE
ETDNIIALLVRLQSGLLDLAEQHTDTIMPGFTHLQTAQPVSFGHHVMAWFEMLYRDTERL
VDARRRINQMPLGSAALAGTTFPIDRTITAELLGFEGICQNSLDAVSDRDFAIEFTSAAS
ILMMHMSRMSEEIILWMSAQFNFVQIPDRFCTGSSIMPQKKNPDVPELVRGKAARVFGQL
MTLLSLMKSQPLAYNKDNQEDKEPLFDCVDTLTGSLLAFADMLPNITPNKENMRAATMKG
YATATDLADYLVRNGVAFRDAHEVVGNAVALGIKEGVDLSDLSLAQLQQFSNAIGDDVFD
FLTLEGSLAARDHLGGTAPNQVKQAISRGRTRLEVFA
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcggacgctttagtgaagcgactgacagctttgttgctgcctttaccgcatcg
gttggctttgaccaacgctttgctcgccatgatattcaaggctcaatcgctcatgcgacc
atgcttaaagagtgcagtatcttggaagctgatgacgttgcgactatcattgatggctta
caacaagtgctgcgtgaaatcgaagccggtgagtttaactggtcgattgccctagaagac
gtccacatgaacgtcgaatcacgcctgaccgatatcgtcggcgcagtgggcaaaaaactg
cataccggacgcagccgtaatgaccaagtggcgactgacattcgtctttggttacgtgaa
gagaccgataatatcattgcgctattggttcgcttacaaagtggcttacttgatttggct
gagcagcataccgataccatcatgccaggcttcacccatttgcaaaccgcgcagcctgtc
agctttggtcatcatgtcatggcatggtttgaaatgctgtaccgtgataccgaacgcttg
gtcgatgcacgtcgacgtatcaatcaaatgcctcttggtagtgccgcacttgctggtaca
acgttcccgattgaccgtaccattactgctgaactgttagggttcgaaggtatttgccaa
aactcgcttgatgccgtatcggatcgtgattttgcgattgagttcacctcggcagcgtct
attttgatgatgcacatgtcacgcatgagtgaagagattattttatggatgtccgcgcaa
tttaactttgtgcaaatccctgaccgcttttgtactggctcatctatcatgccgcaaaag
aaaaaccctgacgtgccagagttagttcgtggtaaagcggcgcgcgtatttgggcaattg
atgacgttacttagcctaatgaagagtcagccacttgcttataataaagacaaccaagaa
gataaagaaccgctatttgattgtgttgataccttgaccggttcgttattggcgtttgct
gatatgctaccgaatattacacccaataaagaaaacatgcgcgccgcaacgatgaaaggg
tacgctactgcgaccgatttagccgattatctggtgcgcaatggtgttgcattccgtgat
gctcatgaagtcgttggtaatgccgttgcgttaggcatcaaagaaggcgtggatttgagc
gatttatcattagcacaactacagcaatttagtaatgcgattggcgatgatgtttttgac
tttttgactttagaaggttcacttgccgctcgtgaccacttgggtggtactgcgcccaat
caagtgaagcaagccatcagccgtggacgtacccgcttagaagtatttgcgtaa

DBGET integrated database retrieval system