KEGG   Psychrobacter arcticus: Psyc_0375Help
Entry
Psyc_0375         CDS       T00256                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
par  Psychrobacter arcticus
Pathway
par00270  Cysteine and methionine metabolism
par00920  Sulfur metabolism
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:par00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Psyc_0375 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psyc_0375 (metX)
Enzymes [BR:par01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Psyc_0375 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     Psyc_0375 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Esterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AAZ18244
UniProt: Q4FUR4
Position
complement(465913..467250)
Genome map
AA seq 445 aa AA seqDB search
MNSVGVVKPQTLHFAEPLTLECNRTLPSFELIIETYGTLNSDKSNAVLICHALSGSHHAA
GFHSDNDKKAGWWDNMIGPNKSIDTNRFFVVCVNNIGSCFGSTGPTSINPESSKAQVYGP
DFPLVTIKDWVKTQAMLSDRLEIDVWHAVVGGSMGGMQALQWAADYPSRLKRCVVIASTP
KLSAQNIAFNEVARQSILSDPDFKNGRYLQAGTYPRRGLILARMVGHITYLTDDAMKAKF
GRDLKSGKFMYGYDVEFQVESYLRYQGERFSENFDANTYLLMTKALDYFDPTRDYPLTQS
AQPIDSLVPEELLASSLVESVKADSSEDELAKTLADSADIDNISASNHQELTALKAAFAH
TECQYLIVSFTTDWRFAPERSQEIVDALMATGKPVSYINVDAPHGHDSFLFDIPRYMGAV
KGFLNAPFMTDNQSKNSQQKLGARS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgaactcagtaggagtcgtcaagccccagactcttcattttgctgagccattaaccttg
gagtgtaatcgcactttgccgtcgtttgagctgataattgagacgtacggtacgcttaat
agcgacaagtcaaacgccgttctgatttgccatgcgctatcaggcagtcatcacgcggca
ggctttcatagcgataatgacaaaaaagccggctggtgggataatatgattggacctaac
aagtccatcgataccaatcgtttttttgtcgtctgtgttaacaatattggtagctgcttt
ggctctaccggtccaacgtcgataaatccagagagcagtaaagcacaagtatatggacct
gactttccactggtcactatcaaagattgggtcaagacccaagccatgctttcagatcgc
ttagagattgacgtctggcatgccgtcgtcggtggttcaatgggtggtatgcaagccctg
caatgggcagctgactatccaagcagactaaaacgctgtgtggtcattgccagtacacct
aagctgtctgcacaaaatatcgcctttaacgaagtggcacgccagtctattttatcagac
ccagattttaaaaacggacgctatctgcaagcagggacttatcctcgtcgcggacttatc
cttgcgcgaatggtaggacatattacttatctgaccgatgatgcgatgaaagccaagttt
gggcgtgatttaaagtcgggcaagtttatgtatggttatgatgtcgaattccaagtcgaa
agctatctgcgctatcaaggcgagcgctttagtgaaaacttcgatgccaatacctatttg
ctgatgaccaaagccttggattactttgacccaacgcgtgactatccattaacgcagtca
gcacagcctatagattctttagtgccagaagagcttttagcttcatcccttgtggagtcc
gtaaaagcggatagtagcgaagatgaattggcaaaaactttagcggacagtgcggatatc
gacaatataagcgcaagcaatcaccaagagctgacagctctgaaagccgcgtttgctcat
actgagtgccaatatttgattgtatcgtttaccactgattggcgttttgcacccgagcgc
tcacaagagattgttgatgcactgatggcgaccggcaaacctgtcagctatatcaatgtt
gatgcgccgcacggtcatgactctttcttatttgatatcccgcgttatatgggtgccgtc
aaaggtttcctaaatgcgccatttatgactgacaaccaaagcaaaaatagccagcaaaaa
ttaggagcacgctcatga

DBGET integrated database retrieval system