KEGG   Psychrobacter arcticus: Psyc_1310Help
Entry
Psyc_1310         CDS       T00256                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
par  Psychrobacter arcticus
Pathway
par00071  Fatty acid degradation
par00072  Synthesis and degradation of ketone bodies
par00280  Valine, leucine and isoleucine degradation
par00310  Lysine degradation
par00362  Benzoate degradation
par00380  Tryptophan metabolism
par00620  Pyruvate metabolism
par00630  Glyoxylate and dicarboxylate metabolism
par00640  Propanoate metabolism
par00650  Butanoate metabolism
par00900  Terpenoid backbone biosynthesis
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01130  Biosynthesis of antibiotics
par01200  Carbon metabolism
par01212  Fatty acid metabolism
par02020  Two-component system
Brite
KEGG Orthology (KO) [BR:par00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psyc_1310
   00630 Glyoxylate and dicarboxylate metabolism
    Psyc_1310
   00640 Propanoate metabolism
    Psyc_1310
   00650 Butanoate metabolism
    Psyc_1310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Psyc_1310
   00072 Synthesis and degradation of ketone bodies
    Psyc_1310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psyc_1310
   00310 Lysine degradation
    Psyc_1310
   00380 Tryptophan metabolism
    Psyc_1310
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psyc_1310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psyc_1310
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psyc_1310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:par04147]
    Psyc_1310
Enzymes [BR:par01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Psyc_1310
Exosome [BR:par04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyc_1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt TP53IP5
Motif
Other DBs
NCBI-ProteinID: AAZ19160
UniProt: Q4FS48
Position
1579271..1580851
Genome map
AA seq 526 aa AA seqDB search
MSNKNNHPNSPVIETTVVKASDAKSTDTATGKAATEESKKPTVFDTAVKSDATDAKKTDA
KAAEPKAASTKKEAAKNSDVAPAKKTNTAAKKASTSKLSSGQNRVAILGGNRIPFARSNG
SYADVSNTDMLTAALDGLVERYNLQDEKIGEVVAGAVMKLSRDINLTREATLNTALNPHT
PTYDISQACGTGLQATFASANKIALGIIDSAITGGVDSTSDAPIAVGDGLRKVLIKLGAA
KDNKQRLKALMGLNPKDLLDTPKNGEPRTGLSMGDHQAITTLEWNISREAQDKLAFDSHQ
NLTRAYDEGFFDDLITPYKGLTRDNNLRPDTTLEKLAKLKPVFGKKNAKPTMTAANSTPL
TDGASCILLGTDEWAAAHGLKPLAYIVHQETAAVDFIGKSGDTEGLLMAPAYAVPRMLER
ASLTLQDFDFYEIHEAFASQVLSTLAAWEDEKFCEERLGLDAPLGSIDRSKLNVNGSSLA
AGHPFAATGARILATAAKLLDQKGSGRALISICAAGGQGVTCILEK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacaaaaacaatcacccaaatagtcctgttatcgaaaccactgtggtaaaagcc
agtgatgcaaaaagcaccgatactgctactggcaaagcggcaactgaagaatcaaagaag
cccactgtatttgatactgcggtgaaatcagacgccactgatgctaaaaaaacagatgcc
aaagcagcagagccaaaagctgccagcactaaaaaagaagcggctaaaaattctgatgtg
gctcctgctaagaaaacaaatactgcggctaaaaaagccagcacgagcaaacttagctca
ggccagaaccgtgtggctatcctaggtggcaaccgtatcccatttgctcgttcaaacggt
tcatatgctgatgtcagcaacactgatatgctaactgccgcgttagatggtttggttgag
cgttataacttgcaagacgaaaaaattggtgaagtggttgctggtgcagtcatgaaacta
agccgtgatatcaaccttactcgtgaagcgacattaaataccgcgcttaatccacatacc
ccaacgtatgatatctctcaagcgtgtggtactggcttgcaagcgacgtttgcttctgcc
aacaaaattgcgcttggtattatcgattcagccattaccggcggtgttgatagcacttct
gatgcgcctatcgcagtcggcgatggcttacgtaaagtattgatcaaattgggtgcggct
aaagacaacaaacaacgcctaaaagcattgatgggtctgaatccaaaagacttacttgat
accccgaaaaatggtgagccacgtactggtttatcaatgggtgaccatcaagcgattacc
acacttgaatggaacatcagccgtgaagcgcaggacaaacttgcctttgatagtcatcaa
aacttaacacgcgcttatgacgaaggtttctttgatgatctaatcaccccgtataaaggt
ctgactcgcgataacaacttgcgtccagatacgactttagagaagcttgctaagctaaag
cctgtctttggtaaaaagaatgccaagccaaccatgactgctgctaactctaccccattg
acagatggtgcatcttgcatcctattgggtactgatgagtgggctgccgcacatggtcta
aaaccattggcatatatcgttcatcaagaaacagccgcggtcgacttcattggtaaatct
ggtgatacagaaggtctactgatggcgccagcttacgctgtaccgcgtatgcttgagcgt
gctagtctgacactacaagatttcgatttttatgaaattcacgaagcttttgcctcacaa
gtgttatcaacccttgcggcatgggaagacgagaaattctgtgaagagcgtctaggactt
gatgcgccattaggctcgattgatcgtagcaaactaaacgtcaacggctcatcacttgct
gcaggtcatccatttgctgcaaccggtgctcgtattctagctaccgctgctaaattacta
gatcaaaaaggttcaggtcgtgcactgatctctatctgcgcggcgggtggtcaaggtgtg
acttgtatcctagaaaaatag

DBGET integrated database retrieval system