KEGG   Psychrobacter arcticus: Psyc_1396Help
Entry
Psyc_1396         CDS       T00256                                 

Definition
(GenBank) probable Haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
par  Psychrobacter arcticus
Pathway
par00625  Chloroalkane and chloroalkene degradation
par01100  Metabolic pathways
par01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:par00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyc_1396
   00361 Chlorocyclohexane and chlorobenzene degradation
    Psyc_1396
Enzymes [BR:par01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Psyc_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6 Put_Phosphatase
Motif
Other DBs
NCBI-ProteinID: AAZ19244
UniProt: Q4FRW4
Position
1688186..1688881
Genome map
AA seq 231 aa AA seqDB search
MSSIYSAPILVFDVNETLLDIDTLTPLFTRLFGDENRLREWFAQLVLYSQTMTLSGLYTP
FGELGVGALQMTADIHAVTLTEEDIQEFKQRMSETPAHPDVIPALTKLRDAGFRLVTLTN
SAPSTSPTRLEKAGLSEFFEQNFSVDSVRQFKPAPAIYQMVASELSVETSELCLVACHIW
DTIGAQAAGCQGAFVTRPYNALLSAPNVPKPDFIASDLITLAEHIINHQSS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctatctactcagctccgattctcgtattcgatgtcaatgaaacgctcctagat
atcgatacgctcacgcccttattcacgcgattatttggggacgaaaatagactcagagag
tggttcgcgcaattggtactttattcgcaaaccatgactttatctggtctttacacgcct
tttggcgagcttggcgttggtgccttgcaaatgaccgcagatattcatgccgttacgcta
acagaagaagatatacaggagtttaagcagcgcatgagtgagacgccagctcaccctgac
gttatccctgctttgactaaactgcgtgatgcaggatttagattggtgaccttgaccaac
tcagcccccagcacctctccgacacggcttgaaaaagcaggactgagtgaattctttgag
cagaatttcagtgttgacagtgtccgtcaatttaaacctgcaccggcaatatatcagatg
gtcgccagcgagctgtccgttgagacctcagagctatgtcttgtagcctgtcatatctgg
gataccatcggtgctcaagctgctggctgccaaggagcttttgtaacccgaccttataat
gcgctactttcggcacccaacgtaccaaaacccgacttcatcgcttcagacctcatcacc
cttgctgaacacattattaatcatcaaagctcttag

DBGET integrated database retrieval system