KEGG   Psychrobacter arcticus: Psyc_1399Help
Entry
Psyc_1399         CDS       T00256                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
par  Psychrobacter arcticus
Pathway
par00071  Fatty acid degradation
par00280  Valine, leucine and isoleucine degradation
par00281  Geraniol degradation
par00310  Lysine degradation
par00362  Benzoate degradation
par00380  Tryptophan metabolism
par00410  beta-Alanine metabolism
par00640  Propanoate metabolism
par00650  Butanoate metabolism
par00903  Limonene and pinene degradation
par00930  Caprolactam degradation
par01040  Biosynthesis of unsaturated fatty acids
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01130  Biosynthesis of antibiotics
par01200  Carbon metabolism
par01212  Fatty acid metabolism
Module
par_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psyc_1399
   00650 Butanoate metabolism
    Psyc_1399
  Lipid metabolism
   00071 Fatty acid degradation
    Psyc_1399
   01040 Biosynthesis of unsaturated fatty acids
    Psyc_1399
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psyc_1399
   00310 Lysine degradation
    Psyc_1399
   00380 Tryptophan metabolism
    Psyc_1399
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psyc_1399
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psyc_1399
   00281 Geraniol degradation
    Psyc_1399
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psyc_1399
   00930 Caprolactam degradation
    Psyc_1399
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Psyc_1399
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psyc_1399
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Psyc_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 2-Hacid_dh_C DAO F420_oxidored AlaDh_PNT_C NAD_binding_8 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAZ19247
UniProt: Q4FRW1
Position
1691898..1694069
Genome map
AA seq 723 aa AA seqDB search
MSTNSVNAINELNSFSAESDNGIITVTIDQADRKMNVIGDGFNEAFAALTDAFISDAEAK
GLILTSGKSTFVVGADIDQLATIETAEQAFDLVEDLKASLRKLETSGKPVVAAITGTALG
GGLELALACHYRIAIDSPKTKLGLPEVKLGLLPGGGGTQRLPRLVGIQKALELMTQGKEL
SPQQAVEIGLIHDVAYDNEELIKKAKKWINNNPQASQPWDNKGFKIPGGDSKNPKIVPIF
SIAPAMANQKSHGNYPAITHILSSVFEGCLTDIDNGLKIESRFFVACALSDVSKNMINTL
WTQLNSIKKGQSRPEGFEKSKVSKVGILGAGMMGAGIAYVSAKAGMEVVLLDTALEGAEK
GKNYSTKLLDKAISRGQSTEEKKQALLDLIKTTTSYDDLEGCDLIIEAVFEDVDIKAECT
RKSEVVIPETAVYASNTSTLPITELARASTRPKQFIGLHFFSPVDKMPLVEIIVGEETDD
ATLAKGFDYVGQIGKTPIVVNDSRGFYTSRVFGTYVSEGIAMLGEGVHPRSIEVAGMKSG
MPMPPLALQDEVSLSLSLHVMQQTKRALESEGKTFTPHPAMPVVEKMVNELGREGKKVTK
GFYDYPENGEKRLWPKLTELYPTKDEQPSQQDLVDRLLYVQANETAKCFEENVVRTVADA
NVGSIFGWGFAPNQGGTLQFVNSVGVDKFVERSRELASKYGKRFEPAKILVEMAESGQEF
SDE
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaacagcgtaaatgccattaatgaattaaacagtttttctgcagaatcagac
aacggcattatcaccgttactattgatcaagctgaccgtaaaatgaacgtgattggtgat
ggttttaatgaagcatttgcggcattaactgatgcatttatcagtgatgcagaagcgaaa
ggtttaattttaacctctggtaaatcaacctttgtggttggggcagatattgatcaacta
gccactatcgaaactgctgagcaagcgtttgacttagtagaggatttaaaagccagccta
cgtaagcttgagacttctggcaagccagtggttgccgcaattaccggcactgccttaggt
ggtggtttagagctggctttagcttgtcattatcgcatcgctattgactcaccaaagaca
aaacttggtttacctgaagtcaaacttggtttattacctggcggtggtggcactcagcgt
cttccacgtctagtcggtatccaaaaagcacttgaactaatgacgcaaggtaaagagctt
agcccacagcaagccgttgaaatcggtcttatccatgacgtggcttacgacaatgaagag
cttatcaaaaaagccaaaaaatggatcaacaacaatcctcaagctagccagccatgggac
aataaaggttttaagattcctggtggtgatagcaaaaaccctaaaatagtaccgatattc
tccattgctcctgcgatggctaatcaaaagtcgcacggcaactatcctgccattacccat
atcttatctagtgtctttgagggctgcttaacggatatcgacaacggtcttaaaatcgag
tcgcgcttttttgtggcttgcgcgttatcagatgtgtccaaaaacatgattaatacgctt
tggacgcagcttaatagcatcaaaaaaggccaatcacgccctgaagggtttgaaaaatct
aaagtgagcaaagtcggcatacttggtgccggtatgatgggcgcaggtatcgcttacgtc
tcagccaaagcgggcatggaagtggtattgttagatacggctctcgaaggcgctgaaaaa
ggtaaaaactattctactaagttgttagacaaggctatcagccgtggtcaatctactgaa
gagaaaaaacaagcgttattagaccttatcaaaaccacaacgtcttatgacgacttagaa
ggctgtgatttaattatcgaagcggtattcgaagatgtagacattaaagctgaatgtacg
cgtaaatctgaagtggttattccagagaccgcggtttatgcatcaaacacgtctaccctg
cctattactgagcttgcaagagctagcacacgtccaaaacagttcatcggtctacacttc
ttctcgccagtagataagatgccattggttgagattattgttggcgaagaaacggatgat
gcaacgctagctaaaggttttgactatgttggtcaaatcggtaagacaccgatcgttgtc
aatgacagccgcggcttctatacctctcgcgtatttggtacttacgtatcagaaggtatt
gcgatgttaggtgaaggtgttcacccacgcagcattgaagtggctggtatgaaatctggt
atgccgatgccgccactcgcactgcaggacgaagtgtcactaagtttgtcattacatgtc
atgcagcaaactaagcgtgccctagaatcggaaggcaaaacctttactccgcatcctgcc
atgccagtagtagaaaagatggttaatgagcttggccgcgaaggtaagaaagtcactaaa
ggcttttatgattatcctgaaaatggtgaaaaacgcttatggcccaagctcactgaactg
tatccaactaaagatgagcagccatctcagcaagacttggtagaccgtttattatacgtt
caagctaatgagaccgcgaaatgtttcgaggaaaatgtcgtacgtacagtggctgatgcc
aatgtaggttcaatctttggctggggctttgcaccaaatcaaggtggtacgcttcagttt
gtcaattcagtaggcgtcgacaaatttgttgaacgtagccgcgagcttgctagcaaatac
ggtaagcgttttgaacctgctaaaatcttagtagagatggctgagtcaggtcaggagttt
agcgatgagtaa

DBGET integrated database retrieval system