KEGG   Psychrobacter arcticus: Psyc_1934Help
Entry
Psyc_1934         CDS       T00256                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
par  Psychrobacter arcticus
Pathway
par00071  Fatty acid degradation
par00280  Valine, leucine and isoleucine degradation
par00281  Geraniol degradation
par00310  Lysine degradation
par00362  Benzoate degradation
par00380  Tryptophan metabolism
par00410  beta-Alanine metabolism
par00640  Propanoate metabolism
par00650  Butanoate metabolism
par00903  Limonene and pinene degradation
par00930  Caprolactam degradation
par01040  Biosynthesis of unsaturated fatty acids
par01100  Metabolic pathways
par01110  Biosynthesis of secondary metabolites
par01120  Microbial metabolism in diverse environments
par01130  Biosynthesis of antibiotics
par01200  Carbon metabolism
par01212  Fatty acid metabolism
Module
par_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:par00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Psyc_1934 (fadB)
   00650 Butanoate metabolism
    Psyc_1934 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Psyc_1934 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Psyc_1934 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psyc_1934 (fadB)
   00310 Lysine degradation
    Psyc_1934 (fadB)
   00380 Tryptophan metabolism
    Psyc_1934 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Psyc_1934 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Psyc_1934 (fadB)
   00281 Geraniol degradation
    Psyc_1934 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psyc_1934 (fadB)
   00930 Caprolactam degradation
    Psyc_1934 (fadB)
Enzymes [BR:par01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Psyc_1934 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Psyc_1934 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Psyc_1934 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Psyc_1934 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AAZ19782
UniProt: Q4FQC6
Position
complement(2382574..2384733)
Genome map
AA seq 719 aa AA seqDB search
MVYQGNRITVTMLEDGIANMQYNAENESVNKFDTETNKQFAEVVNALEKADDVKGLIVTS
SKGVFIAGADITEFVASFKQSEEEIKDWVININDAFNRFEDLPFPKVAAINGAALGGGCE
MTLVCEYRVMSDKAIIGLPETQLGIFPGFGGTVRSTRVIGIDNALELIATGAPKKALDAL
KLGLVDATVAADDLQDAAIDLVKKCISGELDWKAKREEKLVAVKLNQLEQAMAFNSAKGM
IFAKANPKQYPAPALAIAAIEKHVNLPRDKAIEVEAAGFAKAAKTPQAESLVGLFLSDQL
VKKLAKQHSKKAHEINEAAVLGAGIMGGGIAYQAASKGLPIIMKDIKSEQLDLGMGEASK
LLGKMVDRGKMTPAKMGETLSRIRPTLNYGDFAETDIVIEAVVENPNVKRAVLKEVEGLV
KDDCILASNTSTISITFLAEALERPENFVGMHFFNPVHRMPLVEVIRGEKSSEEAIATTV
ALASKMGKVPVVVNDCPGFLVNRVLFPYFGAFDLLLKQGADFAHVDKVMEKFGWPMGPAY
LIDVVGLDTGVHGAEVMAEGFPDRMKPDYKGAIELLYENKRLGQKNGVGFYKYEMDKRGK
PKKVADEATYELLKTTTDSEKQTFDDQAIIDRTMLAFCNETVRCLEDNIVSTPSEADMAM
IMGVGFPPFRGGPCRYIDQMGLDNYLALCEKYAHLGKAYEAPQKIRDMAAAGETFYATA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggtataccaaggaaatcgcattacggtgacaatgctagaggatggcatcgccaacatg
cagtacaacgccgaaaatgagagcgtgaacaagtttgatactgagactaataagcagttt
gctgaagtcgttaatgcgttagaaaaagcggatgacgttaagggcttaattgtcacttca
agcaaaggcgtctttatcgctggtgcggacatcacggaatttgtggcctcttttaagcaa
tcagaagaagaaatcaaagattgggttattaatattaatgacgcctttaatcgctttgaa
gacctaccattcccgaaagtagctgccatcaatggcgccgcgcttggcggtggttgtgag
atgactttagtttgcgaatatcgtgtcatgagtgacaaagcgatcatcggtctaccagaa
actcaactcggtattttcccaggttttggtggtaccgtgcgtagtacgcgtgtcattggt
atcgataatgcgcttgagctgattgcaacgggtgcacctaaaaaagcacttgatgcccta
aaactaggcttggttgatgcgaccgttgctgctgatgatttgcaagatgctgccattgat
ctggtcaaaaaatgtatctcaggtgagcttgattggaaagcgaagcgtgaagagaagctg
gttgctgttaaattaaatcagcttgaacaagcgatggcgtttaacagtgcaaaaggtatg
atttttgccaaagccaatcctaagcaataccctgcgccagcacttgctatcgctgctatc
gaaaaacacgttaacttaccacgtgataaagcaatcgaagtagaagcggcaggttttgca
aaagctgcgaaaaccccacaagcagaaagcttggttggtctgttcttaagcgatcagttg
gttaaaaaattagccaagcaacacagcaaaaaagcacatgaaattaatgaagcggcagta
ttgggtgctggtatcatgggcggcggtatcgcttatcaggcagccagcaaaggcttgcca
atcatcatgaaagacatcaagtctgagcaattagaccttggtatgggcgaagccagcaag
ttattgggcaaaatggttgatcgcggtaagatgacccccgccaaaatgggcgaaacctta
agccgtatccgtcctactttgaattatggcgattttgctgaaacggacatcgttatcgaa
gcagtggtagaaaatccaaatgtgaagcgtgcggtattaaaagaagttgaaggcttggta
aaagacgattgtatcctagcctcaaacacttcgactatctctattactttcttggctgaa
gcacttgagcgtccagaaaacttcgtcggtatgcatttctttaacccagtacaccgtatg
ccattggtcgaagttatccgcggtgagaaatcatctgaagaagcgattgcgaccacggtt
gcactagcctctaaaatgggtaaagtacctgttgtcgttaatgactgcccaggtttctta
gtcaaccgcgtattgttcccatactttggcgcctttgatttattacttaagcaaggtgct
gattttgctcatgtcgataaagtcatggaaaaattcggctggcctatgggtcctgcatat
ctaatcgacgttgttggtttagatacgggtgttcatggcgcagaagtcatggcagaaggt
ttccctgaccgcatgaagcctgattataaaggtgccatcgagcttttatatgaaaacaaa
cgcctaggtcagaaaaatggtgttggtttctataagtatgaaatggacaaacgtggcaag
ccaaagaaagttgctgatgaagccacttatgagctattaaaaacgacgactgatagcgaa
aaacagacctttgatgatcaagcaatcatcgaccgtaccatgctggctttctgtaatgaa
accgtacgctgcctagaagacaacatcgtcagcacgccgtcagaagcggatatggcgatg
atcatgggtgttggttttccaccattccgcggtggcccttgccgttatatcgaccaaatg
ggtttagataactacttggcactatgtgaaaaatatgcgcaccttggcaaagcctatgaa
gccccgcaaaagattcgcgacatggcagcagcaggcgagaccttttacgcaaccgcgtaa

DBGET integrated database retrieval system