KEGG   Psychrobacter arcticus: Psyc_1954Help
Entry
Psyc_1954         CDS       T00256                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
par  Psychrobacter arcticus
Pathway
par00471  D-Glutamine and D-glutamate metabolism
par01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:par00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Psyc_1954
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:par01011]
    Psyc_1954
Enzymes [BR:par01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Psyc_1954
Peptidoglycan biosynthesis and degradation proteins [BR:par01011]
 Precursor biosynthesis
  Racemase
   Psyc_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AAZ19802
UniProt: Q4FQA6
Position
complement(2407053..2408045)
Genome map
AA seq 330 aa AA seqDB search
MKVAASDVANPVNTYSMISDNHTSKEAMANSVIHSQEIDTKGIKADRSAPIGLFDSGIGG
LSVYLHLAHQLPNERYIYYADTLHVPYGNRDSEDIKALTLTAVKWLHQQGCKLIVIACNS
ASAYALETARHHYPQLPIVGLVPALKPAVLASKSGHVAVLATKATLNGTLLNDVITKIAS
PSATRVTKYFDPQLVPWVESGMPENSKTAQNLRQQLQVFAKDGIDQLVLGCTHYPFFKDF
LMQEIEEQKLSMQVVDSGQAIAERVKQLLITNKLSALPIDGLGEKSVVDVGLSGNQIKPP
LTFYATKYHKDMDLLLSCLLGEQTHLLYYR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgccgcaagtgacgttgctaacccggttaatacttactcaatgatttctgat
aaccatacctctaaagaagcgatggctaatagtgtgatacatagtcaggagatagatact
aaagggataaaggcagaccgtagcgcgcccattggtttatttgattctgggatcggtggg
ctgtctgtttatctacatttagcccaccaactacccaatgaacgctatatttattatgca
gataccctgcacgtgccgtatggcaatcgcgatagtgaagatattaaagcattgacatta
acggcagtaaagtggctacatcagcaaggctgcaagcttattgtcattgcgtgtaatagt
gcttctgcctatgcgttagagacagcaagacatcattatccgcagctgccgattgtgggt
ttggtacccgcattgaaacctgcggtattggctagtaaaagtggtcatgtggcggtactg
gcaaccaaagcgactctaaacggtacgctcctgaacgatgtcattactaagatagccagt
ccgagtgcaaccagagtgaccaaatattttgacccgcaactggtgccttgggtagaatca
ggcatgccagaaaacagtaaaacagcgcaaaatctgcgtcagcaattgcaagtatttgca
aaagatgggatagaccagctggtattaggctgcacacattatccgttctttaaagatttt
ttgatgcaagagattgaagagcaaaaactatcgatgcaagtggttgattcagggcaggca
attgcggagcgcgttaagcaattattgataaccaataagctatcagcattacctatagat
gggttgggtgaaaagagtgttgtggacgttggtttgagcggtaaccagattaagccacca
ttgacattttatgcgaccaaataccataaagatatggatttgctgttatcatgcttactt
ggcgaacaaacgcatttactatactatcgttga

DBGET integrated database retrieval system