KEGG   Psychrobacter arcticus: Psyc_2132Help
Entry
Psyc_2132         CDS       T00256                                 

Gene name
dnaK
Definition
(GenBank) chaperone protein dnaK
  KO
K04043  molecular chaperone DnaK
Organism
par  Psychrobacter arcticus
Pathway
par03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:par00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Psyc_2132 (dnaK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:par03019]
    Psyc_2132 (dnaK)
   03110 Chaperones and folding catalysts [BR:par03110]
    Psyc_2132 (dnaK)
   03029 Mitochondrial biogenesis [BR:par03029]
    Psyc_2132 (dnaK)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:par04147]
    Psyc_2132 (dnaK)
Messenger RNA biogenesis [BR:par03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     Psyc_2132 (dnaK)
Chaperones and folding catalysts [BR:par03110]
 Heat shock proteins
  HSP70 / DNAK
   Psyc_2132 (dnaK)
Mitochondrial biogenesis [BR:par03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    Psyc_2132 (dnaK)
  Matrix
   MMC/PAM proteins
    Psyc_2132 (dnaK)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Psyc_2132 (dnaK)
Exosome [BR:par04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Psyc_2132 (dnaK)
  Exosomal proteins of breast cancer cells
   Psyc_2132 (dnaK)
  Exosomal proteins of colorectal cancer cells
   Psyc_2132 (dnaK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Cob_adeno_trans
Motif
Other DBs
NCBI-ProteinID: AAZ19979
UniProt: Q4FPS9
Position
complement(2631349..2633292)
Genome map
AA seq 647 aa AA seqDB search
MGKVIGIDLGTTNSCVAVMEGDKVKIIENAEGTRTTPSIVAYKDDEILVGQSAKRQAVTN
PNNTLFAIKRLIGRRFDDKVVQKDIGMVPYKIAKADNGDAWVEINGKKLAPPQVSAEILK
KMKKTAEDYLGEAVTEAVVTVPAYFNDSQRQATKDAGKIAGLDVKRIINEPTAAALAYGM
DKKQGDSTVAVYDLGGGTFDVSIIEIADVDGEQQFEVLATNGDTFLGGEDFDSALIDFLV
AEFKKDQDVNLKGDSLAMQRLKEAAEKAKIELSSAQSTEVNLPYITADSSGPKHLVVTIS
RSKLESLTEELVQRTMGPCKMALEDAGIKIGDIDDVILVGGQTRMPLVQQKVQEFFGQEP
RKDVNPDEAVAAGAAIQGAVLSGEKTDVLLLDVTPLTLGIETMGGILTPIIEKNTMIPTK
KSQVFSTAEDNQPAVSIQVYQGERKIANQNKQLGRFDLTDIPPAPRGLPQIEVSFDINAD
GIMNISATDKGTGKAQSIQIKADSGLSDEEVEQMIRDAEANAAEDEKFANLAQVRNEADG
RIHAVQKALKDAADKVSDDEKSSVETAISELEAAAKEDDHDDIKAKLEALDNAFLPVSQK
IYADAGAGSEGMDPNQFQQGADNAGENNQADDDVVDAEFTEVEDDKK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagttattggtattgatttaggtacaaccaactcatgtgtcgcagtaatggaa
ggtgataaagttaaaatcatcgaaaatgctgaaggtactcgtacgaccccatcgattgtc
gcttataaagatgacgagatccttgtcggtcagtcagccaagcgtcaagcggtaaccaat
ccaaacaacacgttatttgctatcaagcgtttgattggtcgtcgttttgatgacaaagtc
gtgcaaaaagatattggtatggtgccttataaaatcgccaaagcggataacggtgatgcg
tgggtagaaatcaacggcaaaaaactggcaccaccacaggtttctgctgaaatcttgaag
aaaatgaaaaagacagcagaagactatcttggtgaagcggttactgaagcggttgtaact
gtacctgcttactttaatgactcacagcgtcaagcaaccaaagatgcgggtaaaattgct
ggtcttgatgtaaaacgtatcatcaatgaaccaactgccgctgctcttgcttatggcatg
gacaaaaagcaaggtgatagcactgttgctgtttatgacttaggtggtggtacttttgac
gtatcaatcatcgaaatcgctgacgtcgatggcgagcagcagtttgaagtattagcgacc
aatggtgatacattccttggtggtgaagattttgactcagcgttaattgacttcttagtc
gctgaattcaaaaaagaccaagacgtcaacctaaaaggcgactctcttgcgatgcagcgt
ctaaaagaagcggcagaaaaagcgaagattgagttatcaagtgctcaaagcactgaagtg
aacttgccgtatatcactgctgatagtagtggtcctaagcatttggtggtgactatcagc
cgctcaaaacttgagagcttaactgaagagttagtacaacgtacgatgggtccttgtaag
atggcacttgaagatgcgggcataaaaattggcgatattgatgatgtcatcttagttggt
ggtcagactcgtatgccattggtacagcaaaaagtacaagaattcttcgggcaagagcca
cgtaaagacgtgaaccctgatgaagcagtagcagcgggtgcagcgattcaaggcgcagta
ttgtctggtgaaaaaaccgacgtattgctacttgatgtgacaccattgacgcttggtatc
gaaaccatgggtggcatcttgacgccaatcattgagaaaaacaccatgattccgactaag
aaatcacaggtattctcaacggcagaagacaaccagccagcagttagcattcaggtttat
caaggcgagcgtaaaattgcaaatcaaaataaacagcttggtcgctttgatctaacggat
attccacctgcaccacgtggtttaccacaaatcgaagtaagctttgacatcaacgctgac
ggtatcatgaatatttcagcgactgacaaaggtactggtaaagcacaaagtatccaaatt
aaagccgattctggtttgtcggacgaagaagttgaacaaatgattcgtgatgctgaagcc
aatgctgctgaagacgagaaattcgccaatctagcgcaagtgcgtaacgaagcagatggt
cgtatccatgcagtacaaaaagcgctaaaagatgccgcagataaagtatctgacgatgaa
aaatcatcagtagaaacggctatctctgagcttgaggcagctgctaaagaagatgatcat
gatgacatcaaagctaagcttgaagcattagataatgccttcttgccagttagccagaag
atttatgctgatgcaggcgcaggtagcgaaggtatggatccaaaccagttccaacaaggt
gcggataatgctggcgagaacaaccaagcagacgacgatgtggtcgatgctgagtttact
gaagtagaagacgataagaaataa

DBGET integrated database retrieval system