KEGG   Paraburkholderia sp. SOS3: BTO02_02010Help
Entry
BTO02_02010       CDS       T04966                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00071  Fatty acid degradation
para00072  Synthesis and degradation of ketone bodies
para00280  Valine, leucine and isoleucine degradation
para00310  Lysine degradation
para00362  Benzoate degradation
para00380  Tryptophan metabolism
para00620  Pyruvate metabolism
para00630  Glyoxylate and dicarboxylate metabolism
para00640  Propanoate metabolism
para00650  Butanoate metabolism
para00900  Terpenoid backbone biosynthesis
para01100  Metabolic pathways
para01110  Biosynthesis of secondary metabolites
para01120  Microbial metabolism in diverse environments
para01130  Biosynthesis of antibiotics
para01200  Carbon metabolism
para01212  Fatty acid metabolism
para02020  Two-component system
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTO02_02010
   00630 Glyoxylate and dicarboxylate metabolism
    BTO02_02010
   00640 Propanoate metabolism
    BTO02_02010
   00650 Butanoate metabolism
    BTO02_02010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTO02_02010
   00072 Synthesis and degradation of ketone bodies
    BTO02_02010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTO02_02010
   00310 Lysine degradation
    BTO02_02010
   00380 Tryptophan metabolism
    BTO02_02010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTO02_02010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTO02_02010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BTO02_02010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:para04147]
    BTO02_02010
Enzymes [BR:para01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BTO02_02010
Exosome [BR:para04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTO02_02010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: APR34383
UniProt: A0A1L6HSD0
Position
1:complement(448541..449731)
Genome map
AA seq 396 aa AA seqDB search
MSDTNDPIVIVAAARTPIAAFQGDFAALSAPQLGAAAIEAAVQRAGLQPGQIDEAVMGCV
LPAGQGQAPARQAALGAGLPLSTGSTTVNKMCGSGMRAAMFAHDMLAAGSAEVIVAGGME
SMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAASFDFTREAQ
DAFAIESLTRAKRANEDGSFAWEIAPVKVTTRKGETRVERDEQPFKANLDKIPTLKPAFS
KSGTVTAANSSSISDGAAALVMMRASSAGRLGVKPLARVVGHTTFAQEPAKFTTAPIGAL
RKLFDRNGWRANDVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGAR
ILVTLLGALRHRGLRRGVASLCIGGGEATAMGIELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacacgaacgatcccattgtcatcgtcgcggctgcacgcacgccgatcgccgcg
ttccagggcgacttcgcggcgctgagcgcgccgcagctcggcgcggccgccatcgaggcc
gcggtgcaacgcgcgggtctccaacccgggcagatcgacgaagccgtgatgggctgcgtg
ctgcccgcgggccagggccaggcgccggcgcgtcaggccgcgctcggcgcgggcctgccg
ctttcgaccggcagcacgaccgtcaacaagatgtgcggctccggcatgcgcgcggcgatg
tttgcgcacgacatgctggccgcgggctcggcggaagtcatcgtcgcgggcggcatggag
agcatgacgaacgcgccgtatctgctgcctaaggcgcgcgccggcatgcgcatgggccac
ggccaggtgctcgaccatatgttcctcgacggcctcgaagatgcgtacgacaaaggccgt
ctgatgggcacgtttgccgaggaatgcgcggcgtcgttcgatttcacgcgcgaagcgcag
gacgcattcgcgatcgaatcgctgacgcgcgccaaacgcgcgaacgaagacggttcgttt
gcgtgggaaatcgcaccggtcaaggtgaccacgcgtaagggcgagacgcgggtcgagcgc
gacgagcagcctttcaaggccaacctcgacaagatcccgacgttgaaacccgcattcagc
aagagcggcacggtcacggcggcgaactcgtcgtcgatttcggacggcgccgcggcgctc
gtgatgatgcgcgcctcgagcgccgggcgcctcggcgtcaaaccgcttgcgcgcgtggtc
ggccatacgaccttcgcgcaggaaccggcaaagttcaccaccgcaccgatcggcgcgctg
cgcaaactgttcgaccgaaacggctggcgcgcgaatgacgtcgacctctacgagatcaac
gaagcgttcgcggtcgtcacgatggcggccatgaaggagcacggcttgccgcacgagaag
gtcaacgtgaacggcggcgcctgcgcgctcggtcatccgatcggcgcttcgggcgcgcgc
attctcgtcacgctgctcggcgcgttgcggcatcgcgggctcaggcgcggcgtggcgagc
ctgtgcatcggcggcggcgaagcgacggcgatggggatcgaactcgtctga

DBGET integrated database retrieval system