KEGG   Paraburkholderia sp. SOS3: BTO02_02910Help
Entry
BTO02_02910       CDS       T04966                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00903  Limonene and pinene degradation
para00930  Caprolactam degradation
para01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTO02_02910
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BTO02_02910
Enzymes [BR:para01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BTO02_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: APR34534
UniProt: A0A1L6HTM4
Position
1:635620..636552
Genome map
AA seq 310 aa AA seqDB search
MSWQSALACWILRRQCLPHTKRPEVSAEHARAMTARRVWSPHVPRGWQLREQYGESDWPL
RGEWLDPEAAVGSARVPTLLYLHGGGYYFCSPRSHRAVSFGLATRTGARVFSLDYRLAPE
HRFPAALDDAIAAYRRLIAACALPQTLVVAGDSAGGGLALATLVALRDAGDPLPAGALLF
SPWTDLAATGASIETNDGADPMFSGASVARAARLYLGDTPATHPYASPVYADMRNLPPLF
IQAGRTEVLLDDARRVATRATQAGVAVEFEVWPKVPHAWHLWTPFMPEARRALDDAAHFV
QRVMLLRDAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaagcgcgttggcctgctggattctgcgccgccagtgtctgccgcacaca
aagcgtcccgaagtcagtgccgaacacgcgcgcgcaatgaccgcaaggcgcgtgtggtcg
ccgcatgtgccgcgcggctggcagttgcgtgagcagtacggggaaagcgactggccgctg
cgcggcgaatggctcgaccccgaagcggccgtcggttcggcgcgcgtgccgaccctcctc
tatctgcacggcggcggctactatttctgctcgccgcgctcgcatcgcgccgtatcgttc
ggcctcgcgacgcgcacaggcgcgcgtgtcttctcgctcgactaccggctcgcgcccgag
catcgctttcccgcagcactcgacgacgcgattgcggcgtatcgccgtctgatcgcggcc
tgcgccttgccgcaaacgctcgtggtggcaggcgactccgccggcggcggcctcgcgctc
gctacgctcgtcgcgttgcgcgatgcgggcgacccgctgccggcgggcgcgctgctgttt
tcgccgtggaccgatcttgccgcaaccggcgcgtcgatcgaaactaacgacggcgcggat
ccgatgttcagcggcgcctcggttgcgcgagccgcaaggctgtatctcggcgatacgccc
gcgacgcatccgtatgcgtcgccggtttacgcggacatgcggaacctgccgccgcttttc
attcaggccggccgcaccgaagtgctgctcgacgacgcgcggcgtgtcgccacgcgcgcg
acgcaagcgggcgtcgcagtcgagttcgaggtctggccgaaggtgccgcacgcgtggcac
ttgtggacgccgttcatgccggaagcacggcgcgcgctcgacgatgccgcgcatttcgtg
caacgcgtcatgctgcttcgagacgctgcttaa

DBGET integrated database retrieval system