KEGG   Paraburkholderia sp. SOS3: BTO02_05650Help
Entry
BTO02_05650       CDS       T04966                                 

Gene name
amiE
Definition
(GenBank) acylamide amidohydrolase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para00330  Arginine and proline metabolism
para00360  Phenylalanine metabolism
para00380  Tryptophan metabolism
para00627  Aminobenzoate degradation
para00643  Styrene degradation
para01100  Metabolic pathways
para01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:para00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BTO02_05650 (amiE)
   00360 Phenylalanine metabolism
    BTO02_05650 (amiE)
   00380 Tryptophan metabolism
    BTO02_05650 (amiE)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTO02_05650 (amiE)
   00643 Styrene degradation
    BTO02_05650 (amiE)
Enzymes [BR:para01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     BTO02_05650 (amiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: APR34995
UniProt: A0A1L6HUM0
Position
1:1229750..1230787
Genome map
AA seq 345 aa AA seqDB search
MRHGDISSSKDCVGVAVVNYRMPRLHTKDEVIGNARKIGEMVVGMKRGLPGMDLVVFPEY
STHGIMYDAKEMYETAATIPGEETEIFAAACRKADVWGVFSLTGERHEAHPDKAPYNTLI
LMNNKGEIVQKYRKIMPWVPVEGWYPGDCTYVSEGPKGIKISLIICDDGNYPEIWRDCVM
RGAELVVRCQGYMYPSKEQQIMVSKAMAWMNNTYVAVANASGFDGVYSYFGHSAIIGFDG
RTLGECGEEDMGVQYAELSMGLIRDARRNMQSQNHLYKLLHRGYTGTINSGDSVNGVAVC
PFRFYSDWIQDPEGTRKQVEALTRSTPGTQECPIDGIPNEVPTHR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagacacggtgacatttcaagcagtaaggattgcgtgggcgtcgcggtcgtgaactac
cggatgccgcgtttgcacacgaaggatgaagtcatcgggaacgcgaggaagatcggcgag
atggtagtcgggatgaagcgcggcttgccgggcatggacctcgtcgttttccccgaatat
tcgacgcacggcatcatgtacgacgcgaaggaaatgtatgagaccgctgcgacgattccc
ggcgaggagactgaaatttttgccgcggcctgtcgaaaagccgacgtctggggcgtgttt
tcgcttaccggcgagcgccatgaagcgcatccggacaaggcgccgtacaacacgctgatc
ctcatgaacaacaaaggcgagatcgtgcagaaatatcgcaagatcatgccgtgggttccg
gtggagggctggtatcccggtgactgcacatacgtatcggaaggtccgaagggcatcaag
ataagcctcatcatctgcgacgacgggaattacccggagatatggcgcgattgtgtgatg
cgtggagccgaactcgtggttcgctgccagggctacatgtatccgtcgaaagagcagcag
atcatggtgtcgaaagccatggcctggatgaacaacacctatgtcgcggtggcgaacgca
tcgggattcgatggcgtgtattcgtatttcgggcattcggccatcatcggcttcgatgga
cgaacgcttggcgaatgcggcgaggaagatatgggcgtgcagtacgcggagctctcgatg
ggcctgattcgcgacgcgcggcgcaatatgcagtcgcagaatcatctgtacaagctgctg
catcgcggttataccggcacgatcaattcgggcgatagtgtcaatggcgtggcggtgtgc
ccatttcgcttctatagcgactggatccaggacccggaaggaacgcgcaagcaggtcgaa
gcattgacgcgctcgacgccgggcacacaggagtgtccgatcgacggtattccgaacgag
gttccgacgcatcggtga

DBGET integrated database retrieval system