KEGG   Paraburkholderia sp. SOS3: BTO02_05860Help
Entry
BTO02_05860       CDS       T04966                                 

Definition
(GenBank) HAD family hydrolase
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
para  Paraburkholderia sp. SOS3
Brite
KEGG Orthology (KO) [BR:para00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:para01009]
    BTO02_05860
Enzymes [BR:para01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     BTO02_05860
Protein phosphatases and associated proteins [BR:para01009]
 HAD phosphatases
  Other HAD phosphatases
   BTO02_05860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: APR35029
UniProt: A0A1L6HU76
Position
1:1283580..1284296
Genome map
AA seq 238 aa AA seqDB search
MANEQSGRVARAVIFDMDGLLIDSEGIYTSVTQQIASRFGKTFDWEVKQNTIGRGARDLA
EYVVSALGLPMTAEEFLVEREPLLRAGFANAPAKPGAASLVRHLAERGVPIAVGTSSSRP
FFDIKTSRHQDWFCLFDVVVTADDQDVRNAKPAPDIFLVAARRLGVVPGDVLVFEDSPFG
VTAAREAGMHVIAVPDPAMSAARFAHAHAMLGSLDQFEPQQWGLPARVQPAASFIGQP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgagcagtccgggcgagtcgcacgtgcggtcatcttcgatatggatggactg
ctgatcgattcggaaggcatctatacatcggtcacgcagcagattgcttcgcgtttcggc
aagaccttcgactgggaggtcaagcagaatacgatcggacgcggcgcgcgcgatctggcc
gagtacgtcgtaagcgcgctcggtctgccgatgaccgcggaagaatttctcgtcgagcgc
gagccgctgttgcgcgccggcttcgccaatgcgccggcgaaaccgggtgcggcgtcgctg
gtgcggcatctggcggaacggggcgtgccgatcgccgtcggcacgagctcgtcacggccg
ttcttcgatatcaaaacgtcgcggcatcaggactggttttgtctgttcgatgtcgtcgtg
acggccgacgatcaggacgtgcgcaacgcaaagccggcacccgatatttttctcgtcgcg
gcacggcgccttggtgtcgtacccggcgacgtgctggtattcgaagattcgccgttcggc
gtaacggctgcgcgggaggccggcatgcatgtcattgccgtgccggatccggcgatgagc
gccgcgcgttttgcgcatgcgcatgccatgctggggtcgctcgatcagttcgagccgcag
cagtggggactgccggcgcgcgtacagcctgcggcgagtttcatagggcagccgtag

DBGET integrated database retrieval system