KEGG   Paraburkholderia sp. SOS3: BTO02_12775Help
Entry
BTO02_12775       CDS       T04966                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
para  Paraburkholderia sp. SOS3
Brite
KEGG Orthology (KO) [BR:para00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BTO02_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: APR36142
UniProt: A0A1L6HXF3
Position
1:complement(2864063..2865073)
Genome map
AA seq 336 aa AA seqDB search
MHSIHLAIWGVATLVAVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVAFAALFNVIAY
FIFHLKVAQTVGRGTIDPGIVDHYVVFGALVGAIGWNIVTWHYGIPSSSSHALIGGLVGA
ALAKSGWGALNIDGLLKTIAFIFISPLLGFVLGSFFMLSVSWLYFRTPPSKVDRRFRRLQ
LLSAGLYSLGHGGNDAQKTIGIIWMLLIATGYASAGADAPPLWVIGGCYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAETGGALTLFLASWLGIPVSTTHTITGAIVGVGATQKLS
AVRWGVAGNIVWAWILTIPASAILAGAGWWFAHRFL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacatctcgccatctggggcgtcgcgacgctcgtagcggtcgcgctcgtg
ttcgacttcatgaacggcttccacgacgcggcgaactcgatcgccacggtcgtttcgacc
ggcgtgctgaagccgcaacaggcggtcgcgttcgcggcgctattcaacgtcatcgcgtat
ttcatctttcacctgaaggtcgcgcagacggtcggcagaggcacgatcgatccgggcatc
gtcgaccattacgtcgtgttcggcgcgctcgtcggcgcgatcggctggaatatcgtgacg
tggcactacggcatcccgtcgagttcgtcgcatgcgctgatcggcgggctggtcggcgcg
gcgctggcgaaatcggggtggggcgcgctgaatatcgacggtctgctgaaaaccatcgcg
ttcatttttatctcgccgctactcggcttcgtgctcgggtcgttcttcatgctgagcgtg
tcgtggctgtacttccgcacgccgccgagcaaggtggaccggcgcttccggcggctgcaa
ctgctgtcggcgggtctgtacagcctcgggcacggcggcaacgatgcgcagaagaccatc
ggcatcatctggatgctgctgatcgcaaccggctatgcgtcggcaggcgccgatgcaccg
ccgctctgggtgatcggcggctgctatctgtcgatggggctcggcacgctgttcggcggc
tggcgcatcgtgcgcacgatggggcagaagatcacgaagctgaagccggtcggcggtttt
tgcgcagaaaccggcggcgcgctgacgctgtttctcgcgtcgtggctcggcattccggtg
tcgacgactcacacgatcaccggcgcgatcgtcggtgtcggcgcgacgcagaagctgtcc
gccgtgcgctggggcgtcgcgggcaatatcgtatgggcgtggattctgacaatcccggcg
tccgcgatactcgcgggcgccggctggtggttcgcccatcggttcctgtaa

DBGET integrated database retrieval system