KEGG   Paraburkholderia sp. SOS3: BTO02_20370
Entry
BTO02_20370       CDS       T04966                                 

Definition
(GenBank) sorbitol dehydrogenase
Organism
para  Paraburkholderia sp. SOS3
SSDB
Motif
Pfam: FAD-SLDH DUF599
Other DBs
NCBI-ProteinID: APR37917
UniProt: A0A1L6I2G9
Position
2:complement(61534..62226)
AA seq 230 aa
MTKADTRRARTRPSRETRAARSESRRAWLARVCASAAALAAGSTAGFAATAASVGASVGA
SVGASNAGSPRAALGAADTASTAAARIAGPHAGTQPPSGGGLDAFLALSQKLTGHSSFNA
VLAKRAYDALSKADSQFMQNVATLNTWLHAHGGVPSDTVIAALQTDSPALANTVAAIVRA
WYLGLVGEMPNVQVIAYESALMFDPINDVLTVPSYCRDVPFYWSQKPTNA
NT seq 693 nt   +upstreamnt  +downstreamnt
atgacaaaagcagacacgcggcgcgcgcgcacgcggccgtcgcgagagacgcgtgcggcg
cgctccgaaagccgccgcgcatggcttgcccgcgtatgcgcgtcggccgccgcgcttgcc
gcgggatcgaccgccggcttcgccgcaacggccgcctcggttggcgcttcggttggcgcc
tcggttggcgcttcgaatgccggttcgccgcgcgctgcgctcggcgccgcggacaccgca
tcgactgccgcggcccgcatcgccggcccgcacgctggcacgcagccgcccagcggcggc
ggtctcgacgcttttcttgcgctgtcgcagaagctgacgggccatagcagcttcaacgcg
gtgctcgcgaagcgcgcatacgacgcattgtcgaaagcggacagccagttcatgcagaat
gtcgcgacgctcaacacatggctgcacgcgcacggcggcgtgccgtccgatacggtgatc
gcggcgctccagacagactcgccggcgctcgcgaatacggtcgcggcgatcgtgcgagcg
tggtatctcggcctcgtcggcgagatgccgaacgtgcaggtcatcgcctatgaaagcgca
ctgatgttcgaccccatcaacgacgtgctaaccgtgccgtcctattgccgcgacgttccg
ttttactggtcgcagaaaccgacgaatgcgtga

DBGET integrated database retrieval system