KEGG   Paraburkholderia aromaticivorans: CJU94_00070Help
Entry
CJU94_00070       CDS       T05169                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:parb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CJU94_00070
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:parb03400]
    CJU94_00070
Enzymes [BR:parb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CJU94_00070
DNA repair and recombination proteins [BR:parb03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CJU94_00070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_4
Motif
Other DBs
NCBI-ProteinID: ASV96712
UniProt: A0A248VCU2
Position
1:14587..16698
Genome map
AA seq 703 aa AA seqDB search
MNTPGPTRLHRGEILKVLSRTGGGAIFVLTVSPVRQIRVVVPYNLLPLEPQAGDIWRVEG
RFRYSATHGSQLHATEAYIDMPRGAEIASFLGRNLYFAEVDLRTSKSAYKRLGDGLRLML
DAADYVGIAGALRLELRDAVAFCERWLDFWAEIRLRKVLVQASFSVSSAPLLFKFWGRTA
ANLLTDNPYRYLAFSTWRQVDSAALRVFNIDAESSKRLIGAVEATLYAASSFGDTALADA
SLRRLLSIRLGSTPLVSRAISLAIEHGKLITLKRPVGECVYQTTGLYNIESALRNRLSID
SQPGTSESQRSSGKHFPQGTLSISLMFAEGWSPVGVVSHLASMEEQSLHVVPDQSIVSGL
RASGARTRITTITALFTDGLGRSVPKIIYVYGTEGFNVLLFSKLLHRLPASTDVRLVVRS
KYQLAVGPGPVLQWLMSLTTIQSRTLMSTRRRPRTGIASLLHDIDVGRATLPSSNGYGGA
FRLVPTSGWRETLAATVSEFYAAASAQSVLVILPLPEQCHQFNTLIHQESILYKRETGQS
ASTVKLRGAQFATTGEPIVCHKQVWELGLIPGALGTLLEVLDDARYEVRNGHPVRILAIA
RFTIVGEVTLTAENLSHISLAHALPVQRCQFASSEHVILPLTSSPVVDRLWVHKAVSCAS
EAVALIGDESIFARAVSWTRARRPRRFGALQTPESSMVQEHHL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
gtgaacacgcctggtccaactcgcctgcaccggggcgaaatactgaaagtgctttcgcga
acaggaggtggcgcgattttcgtcctgacggtctcgcctgttcggcagattcgcgtcgtt
gtcccgtacaacctgcttcccctcgagccgcaggccggcgacatctggagggtcgaggga
cgcttcaggtatagcgcgacacatggctcgcaactgcacgcgaccgaggcatacatcgat
atgccgcgaggcgccgagatagccagcttccttggccgtaacctttactttgccgaagtt
gaccttcgcacaagcaagtcagcatacaaacggctgggcgacggattgagacttatgctt
gacgcagccgactatgttggcatcgccggggctttgcgattggaacttcgagatgccgtc
gcattctgtgaacgttggctcgatttttgggcggagatacgcctccgaaaagtgctcgtt
caggcatctttttccgtcagttcggcgccgctcctgttcaaattctggggacgaactgcg
gccaatctcctcacagacaatccataccgatacctcgcgttctcaacttggagacaggtc
gattctgcggcccttcgggtattcaacatagatgcagaatcgtcgaagcgactaatcggc
gccgtcgaagccaccctttatgcagcatcaagctttggcgacactgcgcttgctgacgca
tcgttgcgacggctgctaagcatccgacttggttcgacgccgctggtcagtagagccatt
tcacttgcgattgagcatggaaaactaatcacgctcaagcggccagtcggcgaatgtgtc
tatcagacaacagggctctacaatattgaatcagcactgagaaaccggctgtcgattgat
agccaacccggtacttcagagtcgcaacgctcaagcggaaaacacttccctcaaggtacc
ctgagcatcagcctgatgttcgctgagggatggtcgcccgtcggggtcgtctcgcacctt
gcttccatggaagagcaatcgcttcacgtcgtaccggaccagtccatcgtgagcggtttg
agggcttcgggtgcacggacacgaatcacaactattaccgcactcttcaccgacggtctt
ggacgctcggtacccaaaatcatctatgtctacggcactgaaggattcaatgtcttgctg
ttctcgaaattgttacaccgcctgccggcgtcaacagacgtacgtctggtggtccggtca
aaataccagcttgccgtcggccctggacctgttcttcaatggctcatgagtctcacaacg
attcagtcgaggacgctgatgtcgacgagaaggcggccgcggactggcatcgcgagcttg
ctgcacgacattgacgtcggccgcgctactttgccctccagcaacgggtacggcggagcg
ttccgactggtcccgacctccggttggagagagaccttggccgcaacagtttcggaattc
tatgcggctgcgtcggctcaaagtgtcttggtaatactaccgttgccagaacagtgccac
cagttcaatacgttaattcatcaggagtcgatactctacaaacgcgaaacggggcagtct
gcgtcgaccgtcaaactccggggtgcgcagttcgcgacgactggggagccgattgtctgc
cacaagcaggtatgggagctcggtttgataccgggtgctttgggaacgttgctcgaggta
cttgacgacgcccgatatgaagttcgcaatggccatccggtgcgcatccttgccatcgcc
aggttcaccatagtcggtgaggtgacactgactgcggaaaatctgtcacatatttcgctt
gcgcatgcgctaccggttcagcgttgtcagtttgcttcgtccgagcatgtcattcttccg
ttgacatcgtcccctgttgtagaccgtctgtgggttcataaagctgtatcgtgtgccagc
gaagctgtagcattgattggcgatgaatccattttcgcccgcgccgtaagttggactaga
gcacgccggcctcggcgttttggagcattgcagacgcccgaaagcagcatggtccaggag
catcacctatga

DBGET integrated database retrieval system