KEGG   Paraburkholderia aromaticivorans: CJU94_01205Help
Entry
CJU94_01205       CDS       T05169                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00450  Selenocompound metabolism
parb00970  Aminoacyl-tRNA biosynthesis
parb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CJU94_01205
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CJU94_01205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:parb01007]
    CJU94_01205
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:parb03016]
    CJU94_01205
Enzymes [BR:parb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CJU94_01205
Amino acid related enzymes [BR:parb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CJU94_01205
Transfer RNA biogenesis [BR:parb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CJU94_01205
 Prokaryotic type
   Other AARSs
    CJU94_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1 Ribosomal_60s Zn_Tnp_IS1595
Motif
Other DBs
NCBI-ProteinID: ASV96913
UniProt: A0A248VCX3
Position
1:281933..284068
Genome map
AA seq 711 aa AA seqDB search
MSAPATDLSAGAPSGRRQILVTSALPYANGQIHIGHLVEYIQTDIWVRTLRMHGHEVYYV
GADDTHGTPVMLRAEKEGLTPKQLIDRVWQEHKRDFDSFGISFDNYYSTDSEENRVLSEN
VYLALKEAGLIDARDIEQAYDPVKEMFLPDRFIKGECPKCGAKDQYGDSCEVCGSTYLPT
ELINPYSVVSGATPIRKTSTHYFFRLSDPRCENFLRAWVGGLAQPEATNKMREWLGDAGE
AKLADWDISRDAPYFGFEIPGAPGKYFYVWLDAPVGYYASFKNLAEKRGLDFEAWVRKGS
KAEQYHFIGKDILYFHTLFWPAMLEFSGHRTPTNVFAHGFLTVDGAKMSKSRGTFITAQS
VIETGLNPEWLRYYFAAKLNSTMEDLDLNLDDFQARVNSDLVGKYVNIASRAAGFLIKRF
DGRVQDSAMQHPLLASLRAAVPQIAANYEAREYNRALRQTMELADAVNAYVDTAKPWDQA
KDPANAVALHETCTVSIEAFRLLSLALKPVLPKLAEAVEAFLAIEPLVWADANVPLSSTR
PINAYKHLMTRVDPKQIEALLAANRDSLQATPDAAAPADAKAKSKAAKAAVAEKDETPGI
ISIDDFAKIDLRIAKIVECKAVEGSDKLLQLTLDVGEEKTRNVFSGIKTAYQPEQLVGKL
TVMVANLAPRKMKFGMSEGMVLAASATDEKAEPGLYVLEPDSGAKPGMRVK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcacccgcaaccgatctctccgcaggcgcgccgtcagggcgtcgccagattctc
gtcacgtcggcccttccttatgcgaacgggcaaatccatattggccatctggtcgaatat
atccagacggacatctgggtccggacgttgcgaatgcacgggcacgaggtctactacgtg
ggcgccgacgacacgcacggcacgccggtcatgttgcgcgcggaaaaagaaggtctcacg
ccgaagcagttgatcgaccgcgtgtggcaggaacacaagcgcgatttcgacagcttcggg
atttcgttcgacaattactactcgaccgactccgaagagaaccgcgttcttagcgaaaac
gtctatctggcgctcaaggaagcgggcctgatcgacgcgcgcgacatcgaacaggcgtat
gacccggtcaaggaaatgtttctgccggatcgcttcatcaagggcgaatgtccgaaatgc
ggggcgaaagaccagtacggcgacagctgcgaggtatgcggttcgacgtatctgcccacc
gaactgatcaatccgtactcggtcgtctctggcgccacgccgattcgcaagacctcgacg
cactatttcttccgtctctccgatccgcgttgcgagaacttcctgcgcgcgtgggtgggc
ggcctcgcgcagccggaggccaccaacaagatgcgcgagtggctcggcgacgccggtgaa
gccaagctcgccgactgggacatttcgcgcgacgcgccgtatttcggcttcgaaattccg
ggcgcgccgggcaagtatttttacgtgtggctggacgcgccggtcggctattacgcgagc
ttcaagaatctcgccgaaaaacgcggcctcgatttcgaggcgtgggttcgcaagggttcg
aaggccgagcagtatcacttcatcggcaaggacattctgtatttccacacgctgttctgg
ccggccatgctcgagttttcgggccaccgcacgccgaccaacgtgttcgcgcacggtttc
ctgaccgtggacggcgcgaagatgtcgaagtcgcgcggcacgttcattaccgcgcaaagc
gtgatcgagaccggtctgaatccggaatggctgcgctattacttcgcggccaagctgaac
agcacgatggaagacctcgacctgaacctcgacgacttccaggcacgcgtcaacagcgat
ctggtcggcaagtacgtgaacatcgcgagccgcgccgccggcttcctgatcaagcgcttc
gacggccgggtgcaggacagcgcgatgcaacatccgctgctcgcttcgctgcgcgccgcg
gtgccgcaaatcgccgcgaactacgaagcccgcgagtacaaccgcgcgctacgtcaaacc
atggaactggccgacgcagtcaacgcctacgtcgataccgccaagccgtgggatcaggcc
aaagacccggcgaacgccgtcgcgctgcacgaaacctgcactgtgagcatcgaagcgttc
cggctgctctcactggcgctcaaacccgtgctgccgaagctcgccgaagcggtcgaagcg
ttcctcgccatcgaaccgctggtgtgggccgacgccaacgtgccgctcagttccacccgg
ccgatcaacgcgtacaagcatctgatgacacgcgtcgacccgaagcagatcgaagcgctg
ctggccgccaatcgcgactcgctgcaggccacgccggatgcggcggcgccggccgatgcc
aaggccaaatcgaaggcggcgaaagcggccgtcgcagagaaggacgaaacgcccggcatc
atctcgatcgacgacttcgcgaagatcgatttgcgcattgcgaagattgtcgagtgcaag
gcggtggaaggttcggacaagctgctgcaactcacgctcgacgtcggcgaagagaagacc
cgcaacgtgttttcaggcatcaagaccgcgtatcagccggaacagctagtcggcaagctg
acggtcatggtggccaacctcgcgccgcgcaagatgaagttcggcatgtccgaaggcatg
gtgctggccgcgtccgccactgacgagaaagcggaaccgggcctctacgtgctcgagccg
gatagcggcgcgaagccgggcatgcgcgtgaagtaa

DBGET integrated database retrieval system