KEGG   Paraburkholderia aromaticivorans: CJU94_07475Help
Entry
CJU94_07475       CDS       T05169                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
parb  Paraburkholderia aromaticivorans
Brite
KEGG Orthology (KO) [BR:parb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CJU94_07475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ASV98023
UniProt: A0A248VG64
Position
1:1629900..1630274
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSTQVQYLPEESDPERRQYAFAYTLTIRNTGQVPAQLIARHWVITDSDKNVQE
VKGLGVVGHQPLLKPGEHFEYTSWAVIATPVGTMRGEYFCVAEDGERFDAPVPEFILRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtctcgacgcaggtgcaatatctgcccgaagagtcggac
ccggagcgccgccagtatgcattcgcatacacgctgactatccgtaacaccggccaggtg
ccggcgcagttgatcgcgcgccattgggtgatcacggacagtgacaagaacgtacaggaa
gtgaagggcctgggcgtggtcggccatcagccgctgctcaaaccgggcgagcatttcgag
tacacgagttgggcggtgatcgccacgccggtcggcaccatgcgcggggagtacttctgc
gtggccgaggacggcgagcgtttcgatgcgccggtgccggaattcatcctgcgcatgccg
cgtacgttgcattga

DBGET integrated database retrieval system