KEGG   Paraburkholderia aromaticivorans: CJU94_15680Help
Entry
CJU94_15680       CDS       T05169                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00220  Arginine biosynthesis
parb01100  Metabolic pathways
parb01110  Biosynthesis of secondary metabolites
parb01130  Biosynthesis of antibiotics
parb01230  Biosynthesis of amino acids
Module
parb_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CJU94_15680
Enzymes [BR:parb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CJU94_15680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: ASV99457
UniProt: A0A248VK66
Position
1:3472405..3473415
Genome map
AA seq 336 aa AA seqDB search
MAFNLRNRSLLSLVHHTSRELRYLIDLSRDLKRAKYTGTEQQHLKGVNIALIFEKSSTRT
RCAFEVAAYDQGANVTYIDPSSSQIGHKESMKDTARVLGRMYDAIEYRGFKQEIVDELER
YAGVPVFNGLTDEYHPTQMLADVLTMRENTDKPLPAISYAYLGDARNNMGNSLLLIGAKL
GMDVRIGAPKALWPLDEHIAMCRRFAEETGARLTLTEDPKAAVKGVDFVHTDVWVSMGEP
VEAWKERIHMLLPYQVNMELMKAADNPQVRFMHCLPAFHNSETKVGKQIAAQYPNLANGI
EVTEEVFESPLNIAFEQAENRMHTIKAILVSTLADL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaatctgcgaaacagaagtctgcttagcctcgtgcatcacaccagccgggaa
ctgcggtatctgatcgatctttccagggacctcaagcgcgcgaaatatacgggaacggag
caacagcacctgaaaggcgtaaacatcgcgctgatattcgaaaagagttcgacccgcacg
cgttgcgcgttcgaggtcgccgcgtacgatcagggcgccaacgtcacttatatcgatccg
agttcgtcgcaaatcggccataaggaaagcatgaaagatacagcccgggtgctcgggcgc
atgtacgatgcgatcgaatatcggggcttcaaacaggagatcgtcgacgaactcgaacga
tatgccggcgtacccgtgttcaacggcctgaccgacgaataccaccccacgcaaatgctg
gcggatgtgctgaccatgagggagaacaccgacaaaccgctccccgccatcagttacgcg
tatctgggcgacgctcgcaataatatgggaaactcgttgctgctgatcggcgcgaagctc
ggcatggacgtgaggatcggcgcgccgaaagcgctctggccgcttgacgagcacattgcc
atgtgccggcggtttgccgaagaaacgggagcacgtttaacgctgaccgaagatccgaag
gctgcggtaaagggcgtcgatttcgttcacaccgacgtgtgggtatcgatgggcgagccg
gtcgaagcgtggaaagagcgcattcacatgcttctgccctatcaggtcaatatggaactg
atgaaagcagccgataatcctcaggtccggttcatgcactgcctgcctgcgtttcataat
agcgaaaccaaggtcggcaagcagatcgccgcccagtatccgaatctcgcgaacggcatc
gaagtcacggaagaagtcttcgaatcgccgttgaacattgcattcgaacaggcagagaac
cggatgcatacgattaaagccattctcgtctcgacacttgcggacctctga

DBGET integrated database retrieval system