KEGG   Paraburkholderia aromaticivorans: CJU94_18165Help
Entry
CJU94_18165       CDS       T05169                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00471  D-Glutamine and D-glutamate metabolism
parb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CJU94_18165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:parb01011]
    CJU94_18165
Enzymes [BR:parb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CJU94_18165
Peptidoglycan biosynthesis and degradation proteins [BR:parb01011]
 Precursor biosynthesis
  Racemase
   CJU94_18165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ASV99899
UniProt: A0A248VND2
Position
1:4046708..4047562
Genome map
AA seq 284 aa AA seqDB search
MFTSGAGSRAPVGIFDSGLGGLSVLRAVRAQLPDEAILYAADSLYAPYGERDDDFIADRT
LAIGEWLVKQGAKALVVACNTATAQSIAMVREKLPIPLVGVEPGIKPAALRSKTRVAGVL
ATQVTLRSARFQALLERYAADCRFICQPGHGLVQAVERCDVGSAELRALLRGYLQPMLDA
GADTLVLGCTHYPFLDAAIRDIVGDRLTLIDTSVAIARQLERVLDQHGLRAAPASAGAVL
PRFYSTGDGTHQQQLATTLLHIDAMVEQVSIPSRRTAAPNSHAA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgtccggcgccggctcgcgcgcacccgtcggcattttcgattcaggtctcggc
ggtttgtcggtcttgcgggcggtccgggcacaactgcctgacgaagcaatcctctatgcc
gccgactcgctctacgccccctacggcgagcgcgacgacgatttcatcgccgaccgcacg
ctcgcgatcggcgaatggctggtcaagcaaggcgcgaaggcgctggtggtcgcctgcaac
acggcaaccgcgcagtcgatcgcgatggttcgcgaaaaactgcccattccgctcgtcggc
gtcgaacccggcatcaaacccgccgccttgcggtccaaaacccgcgtcgcgggcgtgctc
gccacgcaagtgacgctacgcagcgcgcgcttccaggcgctgctcgaacgctacgccgcg
gattgccgcttcatttgccagccgggccacgggctggtgcaggccgtggaacgctgcgac
gtcggctccgccgaattgcgcgcgctgctgcgcggctatctgcagccgatgctcgacgcg
ggcgccgacacgctggtgctcggctgcacgcactacccgtttctcgatgcggcgatccgc
gacatcgtcggcgaccggctgacgctgatcgacacgagcgttgcgattgcgcgccagctg
gaacgggtgctggaccagcacggcctgcgtgcggcgccggcaagcgcgggcgctgttctg
ccccgcttttattcgaccggcgacggcacccatcagcagcaattggccaccaccctgcta
catatcgacgcaatggtcgagcaggtgtcgattccgtcgcgccgcacggcagcaccgaac
tcccacgccgcataa

DBGET integrated database retrieval system