KEGG   Paraburkholderia aromaticivorans: CJU94_28200Help
Entry
CJU94_28200       CDS       T05169                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00030  Pentose phosphate pathway
parb00480  Glutathione metabolism
parb01100  Metabolic pathways
parb01110  Biosynthesis of secondary metabolites
parb01120  Microbial metabolism in diverse environments
parb01130  Biosynthesis of antibiotics
parb01200  Carbon metabolism
Module
parb_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
parb_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
parb_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CJU94_28200
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CJU94_28200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:parb04147]
    CJU94_28200
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CJU94_28200
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CJU94_28200
Exosome [BR:parb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CJU94_28200
  Exosomal proteins of colorectal cancer cells
   CJU94_28200
  Exosomal proteins of bladder cancer cells
   CJU94_28200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ASW02007
UniProt: A0A248VSN5
Position
2:complement(1896292..1897899)
Genome map
AA seq 535 aa AA seqDB search
MSTTPNNRASNRPAANQSASCKVSASPQEAPASPAGKWPAPPCTLVIFGAGGDLTKRLLM
PALYNLAVDSLLDGGMKIIGVNHGERETSAWRDDLHQSLEQFAADKASTFHAGKLDDQAW
DWVAQRLEYMAGEFETDDTFAKLKQKLEQTPGGNVIFYLAVSSRFFEPIVERLGKAGLLK
EGEGGGFRRLVIEKPFGTDLASARDLNAHILSYAKETQVYRIDHFLGKDTVQSILAVRFA
NALFEPIWRREYIDSVQITASETIGVEGRGKFYEQTGAFRDMVPNHLFQLLGMVAMEPPN
SFDAEAVRDRKAEIFDAIQPLTPEDVVFGQYDKGPAGAGYREEPDVAPDSTTETYAAARV
FVENWRWAGVPFYLRTGKRLAARRTEISVQLKPVPFRLFRDTPVDALTPNVLTLRIDPAH
GTSFDFNVKRPGPVMQIGAVQSLFAYGDFFAEQANVGYETLLYDCMLGDETLFQRADSIE
TSWCAVDDVLHPKSGGAMPVHGYAAGSEGPAQADALLARCGHAWRPLKQDAVQKK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactacaccgaataaccgagcctccaatcgtcccgccgcgaatcagtcggccagc
tgcaaagtcagcgcgagcccgcaggaagcgccggcatcgccggcgggcaaatggcctgcg
ccgccgtgcacgttggtgatcttcggtgccggcggcgatctcaccaaacggctcctcatg
ccggcgctctataacctcgcggtggacagcctgctcgacggcggcatgaaaatcatcggc
gtgaatcatggcgaacgcgagacgagcgcgtggcgcgatgatctgcatcagtcgctcgaa
cagtttgccgcggacaaggccagcaccttccacgccggcaagctcgacgaccaggcatgg
gactgggtcgcgcagcggctcgaatacatggcgggcgaattcgaaaccgacgataccttc
gcgaagctcaagcagaagctcgagcaaacgccgggcggtaacgtgatcttctatctcgcg
gtcagctcgcgttttttcgaaccgatcgtcgagcgtctcggcaaagcgggtttgttgaag
gagggcgaaggcggcggcttccgccggctcgtgatcgagaaaccgttcggcaccgatctc
gcttcggcacgcgatctgaatgcgcatatcctgtcgtacgcgaaagaaacgcaggtgtac
cgcatcgatcactttctcggcaaggacaccgtgcagagcattctcgcggtgcgtttcgcc
aatgcgctgttcgaaccgatatggcggcgcgagtatatcgacagcgtgcagatcaccgct
tcggaaacgatcggcgtggaagggcgcggcaagttctacgaacaaaccggcgcattccgc
gacatggtgccgaaccatctgttccagttgctcggcatggtcgccatggagccacccaat
tcgttcgacgcggaagccgtgcgcgacaggaaggctgaaatcttcgacgcgatccagccg
ctgacgccggaggacgtggtgttcggtcaatacgacaaggggccggcgggcgccggctac
cgcgaggaaccggacgtcgcgccggacagcacgacggaaacctacgccgcggcgcgcgtg
ttcgtcgaaaactggcgctgggccggggtgccgttctatctgcgcaccggcaagcggttg
gccgcgcgtcgtacggaaatctcggtgcaactgaaaccggtgccgttccgcctgtttcgc
gacacgcccgtcgacgccctcacgccgaacgtgctgaccttgcgcatcgatcccgcgcac
gggacgagcttcgacttcaacgtgaaaagaccgggcccggtcatgcagatcggtgcggtg
cagtcgttattcgcctatggcgacttctttgcggaacaggcgaacgtgggttacgaaacc
ttgctttacgactgcatgcttggcgacgagacgctattccagcgtgccgacagtatcgaa
acgagctggtgcgctgtggatgatgtgctgcatccgaaatccggcggcgctatgccggtg
catggttatgcggccggcagcgaaggtcccgcgcaagcagacgcgctattggcgcgctgc
ggccacgcatggcggccgctgaaacaggatgcagtgcagaagaagtaa

DBGET integrated database retrieval system