KEGG   Paraburkholderia aromaticivorans: CJU94_30440Help
Entry
CJU94_30440       CDS       T05169                                 

Definition
(GenBank) selenide, water dikinase SelD
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00450  Selenocompound metabolism
parb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CJU94_30440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:parb03016]
    CJU94_30440
Enzymes [BR:parb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     CJU94_30440
Transfer RNA biogenesis [BR:parb03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    CJU94_30440
 Prokaryotic Type
    CJU94_30440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ASW03014
UniProt: A0A248VVE9
Position
2:complement(2433183..2434247)
Genome map
AA seq 354 aa AA seqDB search
MTDTPARANTSPRLTSLSHGGGCGCKIAPGLLADLLKRSAPLPFFPDLLVGNDTADDAAV
YRLNDEQAIVATTDFFMPIVDDPFDFGRIAATNALSDVYAMGGKPIMALAIVGMPINVLP
HDVIAAVLKGGESVCAEAGIPLAGGHSIDSVEPIYGLVAIGVVDPKRVKRNAGAQAGDVL
ILGKPLGVGILSAALKKDRLDAAGYAAMIAATTKLNRPGAELSKLDGVHALTDITGFGLL
GHTLELARGSNLTARVRYADLPWLPDVVGFAEAGIFTGASGRNWDAYGKDIVLPSSLPAT
ARTLLTDPQTSGGLLVSCAPKAVSEVLALFRADGFGDACVIGEMVSGEGRVEVI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatactcccgcccgcgcaaacacgtcaccccgtctcaccagtctgtcgcatggc
ggcggttgcggctgcaagatcgcgcccggcctgctcgccgatctcctcaagcgcagcgcg
ccattgccgttcttccccgacctgctggtcggcaacgacacagccgacgacgccgccgtc
taccggctcaacgacgagcaggcgatcgtcgccaccaccgacttcttcatgccgatcgtc
gacgacccgttcgacttcggccgcatcgccgccaccaacgcgctgtccgacgtctacgcc
atgggcggtaagccgatcatggcgctggcgatcgtcggcatgccgatcaatgtgctgccg
cacgacgtgatcgccgccgtgctgaaaggcggggaatccgtgtgcgccgaggccggcatt
ccgctcgcgggcggccattcgatcgattcggtcgagccgatctacggtcttgtcgccatc
ggcgtggtcgacccgaagcgcgtcaagcgcaacgcgggcgcgcaagcgggcgacgtgctg
attctcggtaagccgttgggcgtcggcattctctcggcagcactgaagaaagaccggctc
gacgccgccggctacgccgccatgatcgccgcgacgaccaaactcaatcgtccgggcgcg
gagctgtccaagctcgacggcgtccatgcgctcactgacattacgggcttcggcctgctc
ggccatacgctggaactggcgcgcggctcgaacctgaccgcccgcgtgcgctatgcggat
ctgccgtggctgccggacgtggtcggttttgcggaagccggcattttcacgggcgcttcc
ggacgcaactgggacgcctacggcaaagatatcgttttgccttcctcattgccggcgacg
gcgcgtaccctgctgacggatccgcaaacctcgggcggtctgctggtgtcgtgcgcacca
aaagccgtcagcgaggttctcgcgcttttccgcgccgacggcttcggcgacgcctgcgtg
atcggcgaaatggtcagcggagaaggacgcgtcgaggtcatctga

DBGET integrated database retrieval system