KEGG   Paraburkholderia aromaticivorans: CJU94_36735Help
Entry
CJU94_36735       CDS       T05169                                 

Definition
(GenBank) haloacid dehalogenase type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00361  Chlorocyclohexane and chlorobenzene degradation
parb00625  Chloroalkane and chloroalkene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CJU94_36735
   00361 Chlorocyclohexane and chlorobenzene degradation
    CJU94_36735
Enzymes [BR:parb01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     CJU94_36735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ASW03741
UniProt: A0A248VXI4
Position
pBN2:complement(116589..117305)
Genome map
AA seq 238 aa AA seqDB search
MAFKDFKALSFDCYGTLVDWEAGMVSALQPLATKAGAEISSEELLQLHARHAIALEHATP
WKLYRDLLATVYKRVAEQLSVPVTWDECQRYGRTVGDWPVFPDTANALRQLKKQYKLVVL
SNVDNENFSRTEERLGVRFDAVITAEDIGTYKPDRKNFEYLIEQVRAWDIRPDELLHVAC
SIFHDVEPAKDCGLTTCFIDRRHGMQGSGATPGGKDNTRADFEFRSLAEFAEAIFRRA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaaagacttcaaggcgctttccttcgattgctacggtacgctcgtagattgg
gaggcgggtatggtgtctgccctccagccgttggcgactaaggcgggcgctgaaattagc
tccgaagaactgctccaactgcacgcgcggcacgcgatcgcgttagaacacgcgactccg
tggaagctctaccgggacttgctggcgacggtgtacaagcgggtggccgaacagctatcg
gtacccgtgacgtgggacgaatgccagcggtatgggcgaaccgtaggggactggccggtg
tttcccgataccgcgaacgcgcttcgtcaactgaagaagcagtacaagctggtagtactg
tctaacgtcgacaacgagaacttctcccggaccgaggaacgcctgggagtgcgcttcgac
gctgtcataaccgcggaggacataggcacctataagcccgaccgaaagaacttcgagtac
ttgatcgagcaggtcagagcttgggacatccgacccgacgaactgctgcacgtggcatgc
agcatctttcacgacgtagagcccgctaaagattgcggattgacaacgtgcttcattgac
cgcaggcatgggatgcaaggctccggcgcaaccccgggtggcaaagacaacacgcgtgct
gacttcgagtttcgaagcttggcagagttcgcagaggcgatattccgcagggcttga

DBGET integrated database retrieval system