KEGG   Paraburkholderia aromaticivorans: CJU94_38145Help
Entry
CJU94_38145       CDS       T05169                                 

Definition
(GenBank) toluene monooxygenase
  KO
K15761  toluene monooxygenase system protein B [EC:1.14.13.236 1.14.13.-]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00623  Toluene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    CJU94_38145
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.236  toluene 4-monooxygenase
     CJU94_38145
    1.14.13.-  
     CJU94_38145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TmoB
Motif
Other DBs
NCBI-ProteinID: ASW04104
UniProt: A0A248VYM1
Position
pBN2:383545..383811
Genome map
AA seq 88 aa AA seqDB search
MALFPLSSNFEGDFVLQLVAVDTENTMDEVATAAAHHSVGRRVKARPGHILRVRRQGSKE
CLPRTMKVADSGLKPTECVEVIWEPAQQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggctttgtttcccttgagctccaatttcgaaggcgacttcgtgcttcaactggtggcg
gtcgataccgagaacaccatggacgaagtggcgaccgctgctgcgcatcactccgttgga
cggcgtgtgaaagcgcgtcccgggcatatcctgcgggtgcgccggcaaggtagcaaggaa
tgtttgccccgaacgatgaaagtggctgattcgggcctcaagccgaccgagtgtgttgag
gtcatctgggaacccgcccagcaataa

DBGET integrated database retrieval system