KEGG   Paraburkholderia aromaticivorans: CJU94_38635
Entry
CJU94_38635       CDS       T05169                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00626  Naphthalene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CJU94_38635
Enzymes [BR:parb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CJU94_38635
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ASW04047
UniProt: A0A248VYL4
Position
pBN2:complement(470331..471395)
AA seq 354 aa
MSNKTMKTARLTAEDIHGVWAIMPTPSTPDASNWRSPHTVDLNETARIVEELIAAGVNGI
LSMGTFGECATLTWEEKRDYVSTVVETIRGRVPYFCGTTALNTREVIRQTREFMDIGANG
TMLGVPMWVKMDLSTAVQFYRDVAEAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERMTAFWSSGSMCGPATAIMLRD
AVDQAKETGDWTKAKAISDDMRAADATLFPRGDFSEFSKYNIGLEKARMDAAGWLKAGPC
RPPYTLVPEDYLAGAQKSGKAWAALHAKYSKELKQAAPRRPGHACSQDGESLEK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgtcgaataagaccatgaaaacggcgcgcctgaccgccgaagacatccatggcgtctgg
gccattatgcccacgccgtctacgcccgatgcttccaactggcgcagtccgcacacagtt
gacttgaacgagacggcccgcattgttgaggaactgatcgcggctggagtcaacggcatt
ttgagtatgggcacctttggcgagtgcgctacgctgacctgggaggaaaaacgtgactat
gtttcgacggttgtcgagaccattcgtggtcgtgtgccctatttctgcggcaccacggcc
ttgaatacccgcgaagtcatccgccagacccgtgagtttatggacattggcgccaacggc
accatgctcggcgtgccgatgtgggtgaagatggacctgtccacagcggtccagttctat
cgcgatgtcgcagaggcggtgccagaggctgccattgcgatttatgccaaccccgaagcc
ttcaaattcgacttccctcgccccttttgggcggaaatgtccaaaataccgcaggtggtg
acagccaagtatctgggcatcgggatgcttgacctggacctgaaattggcgccgaacatc
cgcttccttccacacgaggacgactattacgcggccgcacgcatcaatcccgagcgcatg
accgcgttctggtcaagcggttccatgtgcggaccggccaccgccatcatgctgcgcgac
gcggtggatcaggccaaggaaaccggagactggaccaaggccaaagccatctccgatgac
atgcgtgcagccgacgcgaccttgtttccgcgtggcgacttctcggagttctcgaagtac
aacattggtcttgaaaaggcacggatggacgcggctgggtggctcaaggctggaccctgc
cgtccgccctacacccttgttccagaggactacctcgctggcgcacagaaatcaggcaag
gcctgggccgcactgcatgccaagtacagcaaggaattgaagcaggccgccccccgcaga
cccgggcacgcgtgcagccaagacggtgagtcgctcgaaaaataa

DBGET integrated database retrieval system