KEGG   Paraburkholderia aromaticivorans: CJU94_38655
Entry
CJU94_38655       CDS       T05169                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00624  Polycyclic aromatic hydrocarbon degradation
parb00626  Naphthalene degradation
parb00627  Aminobenzoate degradation
parb00633  Nitrotoluene degradation
parb00642  Ethylbenzene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CJU94_38655
   00633 Nitrotoluene degradation
    CJU94_38655
   00642 Ethylbenzene degradation
    CJU94_38655
   00626 Naphthalene degradation
    CJU94_38655
   00624 Polycyclic aromatic hydrocarbon degradation
    CJU94_38655
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     CJU94_38655
    1.14.12.23  nitroarene dioxygenase
     CJU94_38655
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     CJU94_38655
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: ASW04051
UniProt: A0A248VYE0
Position
pBN2:complement(474812..475396)
AA seq 194 aa
MMINTQEDKLVSAHDAEEFHRFFNGHDVALLQEATTLLTREAHLLDIQAYRAWLERCVAP
EVQYQVISRELRAASERRYQLNEAVNIYNENFQQLKVRVEHQLDPQNWANSPKVRFTRFV
TNVMAVKDANAPDLMHIRSNLILHRARRGNQVDVFYATREDKWKRSEGGDLKLVERFVDY
PERVLQTHNLMVFL
NT seq 585 nt   +upstreamnt  +downstreamnt
atgatgatcaatacccaagaagacaagctggtctccgcccacgatgctgaagaatttcac
cgattcttcaacggccacgatgtcgctttgctgcaagaagccaccacgctcctgactcgg
gaagcgcatctgctggatattcaggcttaccgggcctggctggagcgctgcgtggcccca
gaggtgcaatatcaggtcatctcccgcgaactgcgcgccgcttccgaacgccgctatcag
ctcaatgaggccgtgaacatttacaacgagaattttcagcaactgaaagttcgcgttgaa
catcaactggatccgcagaactgggccaacagcccgaaggttcgcttcacgcgcttcgtc
accaatgtcatggccgtcaaagacgcgaatgcccctgacctcatgcacatccgctccaac
ctgattctgcacagggccaggcgcggcaatcaagtggacgtcttctatgcgactcgtgaa
gacaaatggaagcgcagtgaaggtggtgatctcaaattggtcgagcgctttgtcgactac
ccagagcgggtcctccagacccacaacctgatggtcttcctctga

DBGET integrated database retrieval system