KEGG   Paraburkholderia aromaticivorans: CJU94_38660
Entry
CJU94_38660       CDS       T05169                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00624  Polycyclic aromatic hydrocarbon degradation
parb00626  Naphthalene degradation
parb00627  Aminobenzoate degradation
parb00633  Nitrotoluene degradation
parb00642  Ethylbenzene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    CJU94_38660
   00633 Nitrotoluene degradation
    CJU94_38660
   00642 Ethylbenzene degradation
    CJU94_38660
   00626 Naphthalene degradation
    CJU94_38660
   00624 Polycyclic aromatic hydrocarbon degradation
    CJU94_38660
Enzymes [BR:parb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     CJU94_38660
    1.14.12.23  nitroarene dioxygenase
     CJU94_38660
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     CJU94_38660
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske Aromatic_hydrox
Other DBs
NCBI-ProteinID: ASW04052
UniProt: A0A248VZW4
Position
pBN2:complement(475411..476751)
AA seq 446 aa
MSYQNLVSESGLTQKHLIHGDKELFQHELKTIFARNWLFLTHDSLIPSPGDYVTAKMGTD
DVIVSRQNDGTVRAFLNICRHRGKTLVNAEAGNAKGFVCSYHGWGFGSNGELQSVPFEKA
LYGDSINKKCLGLKEVPRVESFHGFIYGCFDKEAPTLIEYLGDAAWYLETIFKHSGGLEL
VGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGQSIFTPLAGNAVLPPEGAGLQM
TSKYGSGIGVLWDAYSGVHSADLVPELMAFGGAKQEKLAKDIGEVRARIYRSHLNCTIFP
NNSILTCSGVFKVWNPIDENTTEVWTYAIVEKDMPEDLKRRMADSVQRTFGPAGFWESDD
NDNMETESQNAKKYQSANSDLISNLGFGKDVYGDDYPGVVGMSAIGETSYRGFYRAYQAH
ISSSNWAEFESKSRNWHVELTKTAVL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagttaccaaaacttagtgagtgaatcgggactgacccagaagcacctgattcatggc
gacaaagaactgttccaacacgaactgaaaaccatcttcgcgcggaactggctttttctc
acccatgacagcctgattccttcgcccggcgactatgtcaccgctaaaatggggaccgat
gatgtcatcgtttcccgccagaacgatggcaccgttcgcgcttttctgaatatttgccgc
catcgcggcaaaacacttgtgaatgcggaagccggcaacgcgaaaggcttcgtttgcagc
taccacggatgggggttcggctccaacggcgaactacaaagtgttccgtttgaaaaagcg
ctgtacggcgactcgatcaacaagaaatgccttggcttgaaggaagttccgcgcgtggag
agcttccacggcttcatctacggttgtttcgacaaggaggcgcccactctcatcgaatac
ttgggcgatgcagcttggtacttggaaaccattttcaagcattccggcggcctagaactg
gtcggccctccaggcaaggtggtgatcaaggccaactggaaggctcccgctgaaaacttt
gtgggtgacgcttaccacgtgggttggacgcacgcttcttcgctgcgctcgggccagtcc
atcttcactccgcttgctggtaacgccgtgctgccccccgaaggggcaggtttgcaaatg
acatcaaaatacggtagtggcatcggtgtgttgtgggatgcatattcgggtgttcacagt
gcagacctggttccggaattgatggctttcggcggcgccaagcaggagaaactggccaaa
gacattggcgaggttcgcgcgcggatttatcgcagccacctgaactgcactattttcccg
aacaacagcatcttgacctgctccggggtgtttaaggtctggaatccgatcgacgaaaac
actaccgaagtctggacctatgccattgtcgaaaaagacatgcccgaggacctaaagcgc
cggatggccgactcagttcagcgcactttcgggcctgccggtttctgggaaagcgacgac
aacgacaacatggaaaccgagtcgcaaaacgctaagaagtaccagtctgccaacagcgat
ctgatttccaacctgggtttcggcaaggacgtttatggtgatgattatcctggcgtcgtc
ggcatgtcagcgatcggcgaaaccagctaccgcggcttttaccgtgcctatcaagctcat
atcagcagctccaattgggccgaattcgaaagtaaatcgcggaattggcatgttgaactg
acgaagaccgccgttctgtaa

DBGET integrated database retrieval system