KEGG   Paraburkholderia aromaticivorans: CJU94_39795Help
Entry
CJU94_39795       CDS       T05169                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00970  Aminoacyl-tRNA biosynthesis
parb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:parb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CJU94_39795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:parb03029]
    CJU94_39795
Enzymes [BR:parb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CJU94_39795
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CJU94_39795
Mitochondrial biogenesis [BR:parb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CJU94_39795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASW04294
UniProt: A0A248VZ67
Position
pBN4:complement(37996..39456)
Genome map
AA seq 486 aa AA seqDB search
MTVKQQICGMAATELVEAIRTKQLSPVEVVDAHLERMEILEPSIHAFCTVTAEAARKNAR
EVEARILRGEKIGALAGVPVGIKDLVCTAGIRTASGSAAYQEFVPDEDDVVVERLKKADA
IIVGKTNVPEFGYSGVGHNPIFETTRNPWNLDLTPGGSSAGSGAAVASGEVPFAIGSDGG
GSIRIPAAHSGIYGIKASMGRVPLYPGCRDERYPGVSSWESLEHIGPMSRTVADSALMLS
VIAGPDPRDRHSLPRADFDWMKSLDGDLKGLRVAYSPDWGYAAVDARVRRIVDEAVRVFE
RDLGCTVEIAHPGWSDPFDAFWAIVAMDTDLRGMRAMAAELGQKMSPHLVAFLNHPWTAE
DFTNAMLTRKAVVNKMWRFMNHYDLLLTPTLTVPPFPVHCQGPEKTEGRMVAPTQWLSFT
YPINLTGQPAASVPAGFTDDGLPVGLQIVGRHLDDRLVLRASAAFEQARPWRNRWPQLLA
QAGLSQ
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaagcaacagatctgcgggatggctgcgaccgagcttgtcgaggcgatccgc
acgaagcaactttcaccggtagaagtcgtcgatgcgcatctggaacgaatggagatactc
gagccttcgattcacgcgttttgcacagtgacggccgaagccgcgcgcaagaatgcgcgc
gaggtcgaagcacgcatcctgcgtggtgagaaaatcggcgcgctggccggcgtaccggtg
ggcatcaaggatcttgtgtgcacggccggtatcaggacggcgtccggatcggccgcgtat
caggaattcgttccagacgaagatgacgttgtcgtcgagcgcctgaagaaggccgacgcc
atcatcgtcggtaaaaccaacgttccagaatttgggtacagcggtgtcggtcataatccg
attttcgaaaccacgcgcaatccctggaatctggacctcaccccgggcggttctagcgcc
ggctccggcgcagcggtggccagtggcgaagttccgtttgcgattggaagcgatggtggc
gggtcgatccgaatccccgcggcacattccggcatctatggcatcaaggcctccatgggg
cgcgttccgctgtatcccggctgccgcgacgagcgctatcccggagtttcaagctgggag
agtctcgagcacatcggcccgatgagtcgcacggtagctgacagcgcgctgatgctatcc
gtgattgcaggcccggatccacgcgatcgtcactcactgccgcgcgccgacttcgactgg
atgaagtcgcttgacggcgacctcaaagggttgcgggtcgcttatagtccggactggggc
tacgccgccgtcgatgcgcgcgtgcgtcgcatcgtcgacgaggctgtgcgcgtcttcgag
cgcgatctcggctgtaccgtcgaaattgcgcatcccggatggagcgatccgtttgatgcg
ttttgggccatcgttgcgatggacacggacctcaggggcatgcgcgcgatggcagcagag
ttaggtcagaagatgtcgccgcacctcgtggcctttctcaaccatccttggacggcagaa
gacttcaccaacgcgatgttgacccgcaaggccgtggtcaacaagatgtggcgcttcatg
aatcactatgatttgttgctcacccccacgctgaccgttcccccgtttcccgttcattgc
caggggccggagaagactgagggccgcatggtcgcgccgacgcagtggctctcgttcacc
tatccgatcaacctcaccgggcaacctgccgcatcggtgccggcaggtttcaccgatgac
ggattgcccgttggcttgcagattgtcggacgtcatttggacgatcgattggtgcttcgt
gcctcggcggcctttgagcaggcccgtccctggcgaaatcgctggccgcaactgcttgcg
caggccggtctctcgcagtaa

DBGET integrated database retrieval system