KEGG   Parabacteroides sp. CT06: CI960_06425Help
Entry
CI960_06425       CDS       T05011                                 

Definition
(GenBank) HAD family phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00010  Glycolysis / Gluconeogenesis
parc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CI960_06425
Enzymes [BR:parc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     CI960_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2
Motif
Other DBs
NCBI-ProteinID: AST53005
UniProt: A0A223HKN0
Position
1460312..1460926
Genome map
AA seq 204 aa AA seqDB search
MEGIKNLIIDLGGVLINLTRNRCIEAFENLGVENIREQITNNYQHKDLFERLELGTISVE
QFRDDIRALSGKPLTDEQIDTAWIAMLGDVPENKLRLLLELRERYNTMLLSNTNELHWKW
SEDTYFSYQGLCAQDFFHKIYLSYELHMLKPNADIFEYVLKDSNLLAEETMLIDDASVNC
RAAELLGMKSYMPQQREDWSHLFK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcataaagaacttgattatagacttgggcggtgtgcttattaacctgactcgc
aaccgttgtatcgaggctttcgagaatttgggcgtggagaatatccgggaacagatcacg
aataactatcaacataaggacttgtttgagcgattagagttgggaacgatttcggtggaa
cagtttcgcgatgatattcgtgccttatcggggaagcccctgacggacgaacaaatcgac
acggcatggatcgccatgttgggagacgtcccggaaaataagttgcgtttgctattggag
cttcgtgaacgctataatacgatgcttctgagcaatacgaacgagcttcattggaaatgg
tccgaagatacctatttctcttatcaaggtctttgtgcccaagatttcttccataagatt
tacctctcttacgaattgcatatgctgaagccgaacgcggatatttttgagtacgtactg
aaggactcgaatcttttagccgaggagactatgctgattgatgacgcttccgtgaattgc
cgggcggctgaattattgggaatgaagtcctatatgccgcagcaaagggaggattggtcg
catctattcaaatga

DBGET integrated database retrieval system