KEGG   Parabacteroides sp. CT06: CI960_07185Help
Entry
CI960_07185       CDS       T05011                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
parc  Parabacteroides sp. CT06
Pathway
parc00030  Pentose phosphate pathway
parc00480  Glutathione metabolism
parc01100  Metabolic pathways
parc01110  Biosynthesis of secondary metabolites
parc01120  Microbial metabolism in diverse environments
parc01130  Biosynthesis of antibiotics
parc01200  Carbon metabolism
Module
parc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
parc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:parc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CI960_07185 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CI960_07185 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:parc04147]
    CI960_07185 (zwf)
Enzymes [BR:parc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CI960_07185 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CI960_07185 (zwf)
Exosome [BR:parc04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CI960_07185 (zwf)
  Exosomal proteins of colorectal cancer cells
   CI960_07185 (zwf)
  Exosomal proteins of bladder cancer cells
   CI960_07185 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AST53145
UniProt: A0A223HL27
Position
1657128..1658594
Genome map
AA seq 488 aa AA seqDB search
MKKADNQLLVIFGASGDLTSRKLLPSLFELYVRGLLPDRFCILGAARTAYGDEEFRAEQH
THILEAQKGKTYDEGLIDDFLENVYYLAFDSTNADEYYKLRERIEFLQEKHDLPDKIIYY
LATPPVMYEIVPQCLLESGLNKTESPDGFRRIIVEKPFGTSLESARQLNDHLRHIFHEEE
IYRIDHYLGKETVQNILVLRFSNGIFEPLWNHNYIDSIEISATETLGVENRGKYYDGAGA
MRDMIQNHLMQLMSFIAMESPSIFEPEPIRDEIVKVFRSIRPYTVLDMDKMVVRGQYIGY
REEKNVAPDSNTETYVAMKFFIDNWRWSGVPFYFYTGKKLPEKSSEVVIHFKSTPHQLFV
GQCSGGSCNKLTIRIQPNESISLKFGLKMPGAGFEVKQVSMDFRYDSLSKSYLPDAYERL
LLDAMLGDSTLYARSDALEASWKFIDPILLHWKEEGSKNLFFYEPGEDGPEETVILGAEK
KVCACQRR
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcagataatcaattattagttatattcggggcgtcgggcgatcttaccagt
cgcaagttgcttccctctttgttcgagttatatgtccggggcttgctgcccgaccgcttc
tgcatcttgggggccgcccgtaccgcttatggtgatgaggagttccgtgcggagcaacat
acgcatatcttggaggcacagaagggaaagacttacgacgagggcttgatcgatgacttc
ttggagaatgtctattacctcgccttcgattccacgaacgccgatgaatactacaaattg
cgtgagcgcatcgagttcttgcaagagaaacatgacttgccggataagatcatctattac
ttggctaccccgccggtgatgtacgagatcgtcccgcaatgtttgctggagagcggtttg
aacaagaccgagtctccagatggtttcaggcggatcatcgtagagaagccgttcggtacc
agcttggagtctgcccgccagttgaacgatcatttacgacatatcttccatgaggaggag
atttatcgtatcgaccattatctggggaaagagaccgtgcagaatatcttggtattgcgt
ttctcaaacggtattttcgagccattgtggaatcataattatatcgattccatcgagatc
agcgctaccgagactttgggggtggagaatcgagggaaatattatgatggagccggggcg
atgcgggatatgatccagaatcacttgatgcaattgatgtcgtttatcgccatggaatct
ccctctatattcgagccggaaccgattcgtgacgagatcgtgaaagtattccgctccata
cgtccgtatacggtgttggatatggataagatggttgtccgcggacaatatatcggttat
cgggaagagaagaacgtagctcccgactcgaataccgagacgtatgtggcgatgaaattc
ttcatcgataactggcgctggagcggtgtgcccttctatttctatacgggaaagaagttg
ccggagaagtcatcggaggtagtgatccacttcaagtctacgccccatcaactgtttgtc
ggtcaatgttcgggaggttcctgcaataaattgaccatccgtatccaaccgaacgagagt
atatccttgaagttcgggctgaaaatgccgggagccggtttcgaggtgaagcaagtcagc
atggacttccgctacgattccctctcgaagagctatcttcctgacgcttacgagcgtctg
ttgctggatgccatgctgggcgattccaccctgtatgctcgtagcgacgctttggaggct
agctggaaatttatcgatccgatcttgctccattggaaagaggagggttcgaagaactta
ttcttctatgagccgggcgaggacggaccggaggaaactgttattttaggtgcggaaaag
aaagtctgcgcctgccaaagaagataa

DBGET integrated database retrieval system