KEGG   Paracoccus sp. BM15: CUV01_02865Help
Entry
CUV01_02865       CDS       T05237                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
paro  Paracoccus sp. BM15
Pathway
paro00220  Arginine biosynthesis
paro01100  Metabolic pathways
paro01110  Biosynthesis of secondary metabolites
paro01130  Biosynthesis of antibiotics
paro01230  Biosynthesis of amino acids
Module
paro_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:paro00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CUV01_02865 (argF)
Enzymes [BR:paro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CUV01_02865 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AUH32469
UniProt: A0A2K9EDU1
Position
complement(571747..572673)
Genome map
AA seq 308 aa AA seqDB search
MKHFLDIHKTDQADLRAIIDKARAIKTARNGRPKGTPDDDQVLAGQMVALIFEKPSTRTR
VSFDVGVRQMGGQTMVLSGSEMQLGHGETIADTARVLSRYVDLIMIRTFEEQTLLDMAEH
ATVPVINGLTNRTHPCQIMADIMTFEEHRGPIAGKKVVWSGDGNNVFASFAHAAGQFGFD
LTFTGPETLDPENVWMDYAAGKGHPVTIERDPAKAVDGADLVVTDTWVSMHDPQSARERR
HNQLRGYQVNEALMARAKPDALFMHCLPAHRDDEATSAVMDGPHSVIFDEAENRLHAQKA
IMRYCLGV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacttccttgatattcacaaaaccgatcaggccgatctgcgcgccatcatcgac
aaagcccgcgccatcaaaaccgcgcgcaacggtcgcccaaaggggacgccggatgatgat
caggtgctggccgggcagatggtggcactgatctttgaaaagccctcgacccgtacccgc
gtcagctttgatgtcggtgtgcgccagatgggcgggcagaccatggtgctgtcaggctcc
gagatgcagttgggccatggcgagaccatcgccgataccgcgcgcgtgctgtcgcgctat
gtcgatctgatcatgatccgcacctttgaagaacagaccctgctggatatggccgagcat
gcgacggtgcctgttatcaacgggctgaccaaccggacccatccctgccagatcatggct
gatatcatgaccttcgaggaacatcgcggtcctattgccggcaaaaaggtcgtctggtcg
ggcgacgggaacaatgtctttgccagcttcgcccacgcagccgggcagttcggctttgac
ctgacctttaccggccccgagacgctggatccggaaaatgtctggatggattatgctgca
ggcaagggccatcctgtcaccatcgagcgtgacccggccaaggccgttgacggggccgat
ctggtcgtcaccgacacctgggtcagtatgcacgatccacaatccgcccgcgaacgtcgg
cacaaccagttgcgcggctatcaggtaaacgaggcgctgatggcgcgggccaagcccgat
gcgctgtttatgcattgcctgcctgcgcatcgcgatgacgaggcaaccagcgcagtcatg
gacggcccgcattcggttattttcgacgaggccgagaaccgtctgcacgcgcagaaggcg
atcatgcgttattgtctgggtgtctga

DBGET integrated database retrieval system