KEGG   Paracoccus sp. BM15: CUV01_05005Help
Entry
CUV01_05005       CDS       T05237                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
paro  Paracoccus sp. BM15
Pathway
paro03010  Ribosome
Brite
KEGG Orthology (KO) [BR:paro00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CUV01_05005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:paro03011]
    CUV01_05005
Ribosome [BR:paro03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CUV01_05005
  Bacteria
    CUV01_05005
  Archaea
    CUV01_05005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AUH32826
UniProt: A0A2K9EQ19
Position
complement(994770..995150)
Genome map
AA seq 126 aa AA seqDB search
MGKENNPRRVAENEAFAKTKMLRTSPQKLNLVAQLIRGKKVDKALADLTFSHKRIAGDVK
KCLQSAIANAENNHGLDVDSLIVAEAWVGKNLVMKRGRPRARGRYGKIMKPFSEITIKVR
QVEEQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggaaaacaatccgcgccgcgtggcggagaacgaagcgttcgcaaaaaccaag
atgcttcgcacctcgccgcaaaagctgaaccttgtcgcgcaattgatccgtggcaagaag
gtcgacaaggctctggccgatctgaccttctcgcacaagcgcatcgccggcgacgtgaag
aaatgcctgcaatcggctatcgcgaatgccgagaacaaccacggccttgacgtcgacagc
ctgatcgtcgccgaagcctgggtcggcaagaacctggtgatgaagcgtggccgtccgcgg
gcacgtggccgctatggcaagatcatgaagccgttttcggaaatcaccatcaaggtgcgt
caagttgaggagcaagcgtaa

DBGET integrated database retrieval system